KEGG   Methanospirillum hungatei: Mhun_2114Help
Entry
Mhun_2114         CDS       T00325                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mhu  Methanospirillum hungatei
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mhun_2114
   00052 Galactose metabolism
    Mhun_2114
   00500 Starch and sucrose metabolism
    Mhun_2114
   00520 Amino sugar and nucleotide sugar metabolism
    Mhun_2114
Enzymes [BR:mhu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mhun_2114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2386026..2386898
Genome map
AA seq 290 aa AA seqDB search
MAEMVRKVVIPAAGLGTRFLPITKAQPKEMLPVVDKPVIQYVVEEAVASGIDDIIIITGR
NKRAIEDHFDRCIELEDKLSSNPGSPSHAYVDITEIPNIHYIRQREPKGLGDAILLTEKH
CNDEPFVVLLGDTITIAPEGELTCTSQMIQAYNKYKKSIIAIEPVPDYKIPDYGIIDGKE
IEKNHFSIVDIIEKPPIAQAPSNLGAIGCYLFTPEIFAQLKQTKPGKGGEIQLTDAIRKL
SGSIGLVTNCRRYDIGDKLGWMKAFFELALQRDEFRDDLMAILREDVCDT
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaatggtcagaaaagtagttatcccggcagcaggacttggaacacggttcctc
ccgataacgaaggcacagccaaaagagatgcttcccgtcgtagacaagccggtgatacag
tatgtggtggaagaagcggttgcctcagggattgatgatattattatcataaccggaaga
aacaaacgggcgatagaggaccattttgatcggtgtatagaacttgaggataaactgtca
tcaaatcccgggtcgccatcacatgcctatgtagacattaccgagattccaaatatccat
tatatcagacagcgtgagccaaaaggacttggagatgcgatccttcttaccgaaaaacac
tgtaatgatgagccttttgttgtcctgcttggagatacgataaccattgcaccagaaggt
gaactgacctgcacctcccagatgattcaggcatataataaatataaaaaatccattatt
gcaattgaaccggtccctgattataaaattccggattatgggataattgatgggaaagag
atagaaaagaatcatttttcaatcgttgatattatagaaaaacctccaattgcacaggcc
ccttcaaaccttggcgcaattggatgttatctcttcaccccggagatatttgcccagctg
aagcagacaaagccggggaaagggggagagatacaactcactgatgctatccggaaatta
tccggatcaatcgggcttgttacgaactgcaggcggtatgatatcggtgataaacttgga
tggatgaaagcattttttgaactggcattacaacgggatgaattcagggatgatctcatg
gctatattacgggaagatgtgtgtgatacctaa

DBGET integrated database retrieval system