KEGG   Methanospirillum hungatei: Mhun_2324Help
Entry
Mhun_2324         CDS       T00325                                 

Definition
(RefSeq) phosphoglycerate mutase 1 family protein (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mhu  Methanospirillum hungatei
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mhun_2324
   01230 Biosynthesis of amino acids
    Mhun_2324
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mhun_2324
  Energy metabolism
   00680 Methane metabolism
    Mhun_2324
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mhun_2324
Enzymes [BR:mhu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Mhun_2324
Exosome [BR:mhu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Mhun_2324
  Exosomal proteins of melanoma cells
   Mhun_2324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2580229..2580975)
Genome map
AA seq 248 aa AA seqDB search
MYTLVLIRHGESLWNRENRFTGWRDIDLSPQGIDEARAAGKALREQGFEFDLAYTSVLKR
AIRTLWLIQEEMDLMWIPVIRTWRLNERHYGALTGLNKIETVEKYGEQQVHIWRRSYDIP
PPAYTPDNLDNPSYHRRYQEIKRSDLPMTECLKDTVARFIPYWNDEIAPVIRSGKRVLIT
AHGNSLRALVKHLDNISDTDIPDLNIPTGIPLVYELDDNLKPVRSYYLGDEEKVKAAMEA
VKNQGKAK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtatacactggttctgattcgtcatggagaaagtctctggaaccgggagaaccggttt
accggctggcgtgatattgatctctccccccagggcattgatgaggcacgggctgcaggc
aaagcgctcagggagcagggttttgagtttgaccttgcgtatacgtcagttctgaaacgt
gccatccggacactctggcttattcaggaagagatggaccttatgtggattccggtgatc
cggacatggcgcctgaatgagcgtcattatggggctctgaccgggctgaataagatcgag
acggtggagaagtatggtgaacagcaggttcatatctggagaagaagctatgacatccct
ccaccggcctatactccggataacctcgataatccatcctatcaccgccggtaccaggag
ataaagagaagcgatctgccgatgaccgagtgtctgaaggatacggtagcacggttcatc
ccgtactggaatgacgagatcgctccggttatcagatcaggaaagcgggttttgataacg
gctcacgggaacagcctgcgggccctggtcaaacatcttgacaatatatcagatactgac
atccctgatctgaatatcccgaccggtataccattggtgtatgaactggatgacaacctc
aaaccggtcagatcctattatcttggcgatgaggagaaggtaaaggccgccatggaagcg
gtgaaaaatcagggaaaagcgaagtaa

DBGET integrated database retrieval system