KEGG   Methanospirillum hungatei: Mhun_2394Help
Entry
Mhun_2394         CDS       T00325                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
mhu  Methanospirillum hungatei
Pathway
mhu00010  Glycolysis / Gluconeogenesis
mhu00020  Citrate cycle (TCA cycle)
mhu00620  Pyruvate metabolism
mhu00633  Nitrotoluene degradation
mhu00640  Propanoate metabolism
mhu00650  Butanoate metabolism
mhu00680  Methane metabolism
mhu00720  Carbon fixation pathways in prokaryotes
mhu01100  Metabolic pathways
mhu01120  Microbial metabolism in diverse environments
mhu01130  Biosynthesis of antibiotics
mhu01200  Carbon metabolism
Module
mhu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mhu_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mhun_2394
   00020 Citrate cycle (TCA cycle)
    Mhun_2394
   00620 Pyruvate metabolism
    Mhun_2394
   00640 Propanoate metabolism
    Mhun_2394
   00650 Butanoate metabolism
    Mhun_2394
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mhun_2394
   00680 Methane metabolism
    Mhun_2394
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mhun_2394
Enzymes [BR:mhu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mhun_2394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR ErmC
Motif
Other DBs
NCBI-ProteinID: ABD42096
JGI: Mhun2394
UniProt: Q2FT06
Position
complement(2643797..2644324)
Genome map
AA seq 175 aa AA seqDB search
MYEIRLHSRGGQGGVTAAKLMALASFRDGKFATAAPFYGAERRGAPIVSFIRIDDKPIKV
YSQIHNPDLIVVLDPSILDLVNVFEGLKPDGKVLINAPDIPKKAEGYQVRYVDLTGIALK
TNLVVAGSPILNTPVIGALAKMGLFSRESAAAAIKEMFSDERNLKAALMAYEELV
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtatgagatacggcttcattctcgtggtggtcagggtggtgtcaccgctgcaaagctg
atggctctagcatcgttcagggatgggaagtttgcaaccgcagcccctttttatggtgca
gagcggcgtggtgctccgattgtctcatttatcaggatagatgataagcccatcaaggtg
tattcgcagatccataatcctgacttaatcgtggttcttgatccttccatccttgacctg
gtcaatgtgtttgaagggctgaaacctgatggaaaggtccttattaatgcccctgatatt
cccaagaaggcagaggggtatcaggttcggtatgtggacctgaccggaattgctctgaag
acaaacctggttgttgcgggaagccccatcctgaacacgccggttattggtgcccttgca
aagatgggtctgttttcacgggagtctgctgctgctgcaatcaaagagatgttctcggat
gaacggaacctgaaagctgccctgatggcgtatgaggagttggtctga

DBGET integrated database retrieval system