KEGG   Methanospirillum hungatei: Mhun_2804Help
Entry
Mhun_2804         CDS       T00325                                 

Definition
hypothetical protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mhu  Methanospirillum hungatei
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mhun_2804
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mhun_2804
   00052 Galactose metabolism
    Mhun_2804
   00500 Starch and sucrose metabolism
    Mhun_2804
   00520 Amino sugar and nucleotide sugar metabolism
    Mhun_2804
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mhun_2804
   00524 Butirosin and neomycin biosynthesis
    Mhun_2804
Enzymes [BR:mhu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Mhun_2804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3075267..3076187
Genome map
AA seq 306 aa AA seqDB search
MQHGEGRIAGAADIGGTNTRVGLIREDGKIVRIEKFPTPVSGNAEDIPLAIARALMDIAG
DIPLAGLGIAAAGPLNIREGILDHPPNIPFDFVPIVAPLKEATNLPVIFQNDCRAAVLGE
VCAGGARGYETVVYITISTGIGGGICTNGKVITGRGGNAGEIGHFPVDTTYNLTCTCGLS
GHWEGYASGRGIPFFFREWCTAHDLPCIYSTTPEILRFSATDPRYAGFRDALAQVNGRGL
SSVIVAYDPDCIILDGTVIQRNPDLLDQALVYTDRYLDLPPCIFSPLNGDAPLIGAAMAV
FHPKMI
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcagcatggtgaaggacggatcgccggtgcagcagatatcgggggaaccaatacccgt
gtcggcctgattcgtgaggacggaaagattgtcaggattgaaaaatttccaacgccggtc
agcgggaacgcagaggacatacccctggctattgcccgggccctcatggatattgcagga
gatatcccccttgccggtcttggcattgctgctgcagggccgctcaatatcagggagggg
atccttgaccatcccccgaacatcccctttgacttcgtcccgattgttgcccccctcaaa
gaagcaaccaaccttccggtgatattccaaaatgactgccgggcagccgttctgggtgag
gtctgtgccggaggggccagaggatatgaaaccgttgtctacatcaccatctcaaccgga
atcgggggcggaatatgtaccaatggaaaggtcatcaccggccggggaggaaacgcaggg
gagatcggtcatttcccggttgatacgacgtataatctcacctgcacctgtggtctttct
ggtcactgggaagggtatgcttcagggagaggaattccattctttttcagggagtggtgt
accgcacatgatcttccctgtatttattcaacgacacccgaaattctccggttctcagct
actgatccccgatatgctggatttcgggatgcccttgcacaagtgaatggccggggactc
tcatcggtgattgtcgcctatgatcctgactgtatcatccttgacggaacggtcatccag
aggaatccagacctgcttgaccaagcacttgtctatactgaccggtaccttgacctccca
ccctgcatattcagccccctgaacggagatgcaccacttattggtgctgcgatggccgta
tttcatccgaagatgatttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system