KEGG   Methanospirillum hungatei: Mhun_2859Help
Entry
Mhun_2859         CDS       T00325                                 

Definition
oligosaccharyl transferase, STT3 subunit
Orthology
K07151  
dolichyl-diphosphooligosaccharide--protein glycosyltransferase [EC:2.4.99.18]
Organism
mhu  Methanospirillum hungatei
Pathway
Metabolic pathways
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3143197..3145761
Genome map
AA seq 854 aa AA seqDB search
MEYSRYLKPFTLILGAIVLLITFFSFIIRTLPAYSGTTDVLMFVGMDDPTYQLRRIEQII
ANYPNVAWFDPMTYFPIGQPMHWGPLFPFLGATICLITGAATRTEIISVSLFLPCVMAAL
MVPVIYLLVSRVADWKAGLAAAFFIAIVPGQFFFRSFYGYLDHHAGEVFFSTLFCLCYLT
ALVYSRKHPVDLKDKETWKIPIFLGILCGITYVLGLALMPTMLLFALIVGIFTPVWFIIQ
RYIGHLGASALVINSVTFLVAIIGFFFIGVHSEGGLNYYTIGHPIAYTLLILANVLLFGF
SYQLRDKPYWYYVGAIIGVTILGIIALAVILPDLFAYMMANANAFFGSDDIHWKTIQEAR
PWSFDDAWRTFQYSLLLFGAGAAVLLYRIRKELCPSHAFTLIWAVVIFYATCQHIRYEYY
LAVPVAILAGIAVGFALDIIRLPFGQKPEISPMDEDHQSGKKKAGKSHDVSRGRSGHPAG
SVKAGSYLFLAIILILALLFSYQALGRDLMMGAYNLNPDWREATEWMNKNTPDPGVDYFA
MYDEKNFTYPDSAYGVMSWWDYGHMITFLGKRMPNANPFQYGVNGPNGSARFFMTKNESE
ADQILANLKTKYVITDYEMDTGKFWAMSTWDDPEVGVYPYQRTFIFPSPDDPKSGVNYPL
LTNEYYQTMISRLHNFDGTYTEPGNVYFLRYMKPSATGLNAPVVVDGGQTNYSAGKALVN
SFNAQENPQYDVILANFGYTDPVEPVPALSHYRLIFESSTRTTPADMHDLRYVKIFEHVK
GAQIPGEGMLELPVKTNTGREFIYRTQSINGTFTVPYPTETTVGAVTIPGKYRNTKNGAE
YQVTEKQVIEGQSI
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atggaatattcaagatatctaaaaccctttactctcatattaggagcaattgttctcctc
attacttttttttcatttattatcagaactcttcctgcatactcaggaactaccgatgtg
ctgatgtttgtcggaatggatgatccgacctatcagttgcgcaggattgaacagattatc
gcaaactatccaaatgttgcctggtttgatccgatgacctacttccccatcgggcagccc
atgcattggggaccgctcttcccctttctcggggccactatctgtctgatcaccggggct
gccaccagaacagagatcatctctgtttcactcttccttccctgtgtgatggcagcactc
atggtcccggtcatctatctcctggtcagcagggtagctgactggaaagccggccttgca
gcggcatttttcatcgcaattgtgccagggcagttcttcttcagatccttttacgggtac
ctggatcatcatgcaggagaagtcttttttagcacactcttttgtctgtgttatcttact
gcactcgtttacagcaggaagcatccggtcgatctcaaagataaggagacttggaagatt
cccatattccttggaattttatgtgggatcacctatgtccttggacttgccctgatgcca
accatgttattgttcgcccttatcgtcgggatcttcaccccggtctggtttattatccag
cgatatatcgggcatctgggagcatcggcactggtcattaattcggtaacgttcctcgtc
gcaatcatcggttttttcttcatcggtgtgcattcagaaggagggctcaattattacacc
atcgggcatcctatagcctatactctcctgattctggcaaatgttctcctctttggattt
tcttatcagcttcgggacaagccctactggtattatgtcggagccattatcggagtaact
attcttggtattattgcccttgcagtcatccttcctgacctttttgcatacatgatggca
aatgccaatgcattctttggttctgatgatattcactggaagactattcaggaagcacga
ccctggagctttgatgatgcgtggaggacattccagtacagtcttcttctcttcggtgca
ggagctgcggttctcctgtatcggatcagaaaagaactctgcccgtcccatgcgtttact
ctcatctgggcggtcgtgatcttttacgcaacctgtcagcatatcagatatgagtactac
ctggcagtaccggttgccatattggcaggaattgccgtaggatttgctcttgatatcata
cggcttcccttcggacaaaaacctgaaatctcgccaatggatgaggaccatcagtcaggt
aagaaaaaagcagggaaaagccatgacgtatcacgagggagatccggccacccagcagga
tcagtgaaagccggatcttacttattcctggcgattattctcattctggctctcctattc
tcatatcaggcactgggccgggatctcatgatgggggcgtacaacctgaacccggactgg
agagaagcgactgaatggatgaacaagaacacccctgatcccggggttgattattttgca
atgtatgatgagaagaatttcacctatccggatagtgcctacggggtcatgtcatggtgg
gattatggacacatgataacattccttggaaaacgaatgcccaatgcaaatcccttccag
tacggggtgaacgggccgaatggatctgccagattctttatgacgaagaacgagagtgag
gcagatcagatacttgccaatctgaagacaaaatatgtcatcaccgattatgagatggat
accgggaaattctgggccatgtctacctgggatgatccggaagtcggtgtctatccctac
cagcggacctttatcttcccaagtccggatgatccaaaatcgggagtcaactatccgctg
ctcaccaatgagtactaccagacgatgatctcccgtctccataactttgacgggacatat
accgaacctggtaatgtatacttcctgcggtatatgaaaccctcggctacgggcctgaat
gcaccggttgtcgttgatggagggcagacgaactattcagcaggaaaagcccttgtgaac
tcatttaatgcacaggaaaatcctcaatacgatgtcatcctggccaacttcggatacacg
gatccggtcgagccagtcccagcactcagtcattaccggctcatctttgagtcaagtacc
aggactactcctgcagatatgcatgatctacggtatgtgaaaattttcgagcatgtgaaa
ggggcacagatacctggtgagggcatgctggaattaccggttaagacgaacaccgggcgg
gaatttatctatcggacacagagtatcaatggtacctttactgtcccatatccgacagag
acaaccgttggtgcggttacaatcccaggaaagtaccgcaacaccaaaaacggagctgaa
taccaggtcactgaaaaacaggtaattgaggggcagagcatttaa

DBGET integrated database retrieval system