KEGG   Mannheimia haemolytica M42548: MHH_c06730Help
Entry
MHH_c06730        CDS       T02635                                 

Gene name
xylA
Definition
xylose isomerase XylA (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
mhx  Mannheimia haemolytica M42548
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MHH_c06730 (xylA)
   00051 Fructose and mannose metabolism
    MHH_c06730 (xylA)
Enzymes [BR:mhx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     MHH_c06730 (xylA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
626189..627508
Genome map
AA seq 439 aa AA seqDB search
MSNYFDKISKVQYEGANSTNPFAFKHYNPDEVVLGKTMAEHLRLAVCYWHTFCWTGNDMF
GVGSLDRSWQKTGDLLQGAKQKAEIAFEFFQKLGIPYYCFHDVDVAPEGNNFKEYQHNFN
TIVDILEQKQAETGVKLLWGTANCFTNPRYMSGASTNPNPEVFAWAAAQVFTAMNATKRL
GGENYVLWGGREGYETLLNTDLKREREQIGRFMQLVVEHKHKIGFNGTLLIEPKPQEPTK
HQYDYDVATVYGFLKQFGLEKEIKVNIEANHATLAGHTFQHEIATATALDIFGSIDANRG
DPQLGWDTDQFPNSVEENTLVMYEILKAGGFTTGGFNFDAKIRRQSTDPYDLFHAHIGAI
DVLALSLKRAAKMLEDQALQKVVDNRYAGWNQDLGLQILNGKASLEDLAKIVETQGLDPK
PVSGQQEYLENLVNSYIYR
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgtctaactatttcgacaaaatctcaaaagtacaatatgaaggggctaattccaccaac
ccgtttgcattcaaacattacaacccggatgaagtggttttaggcaaaacgatggcagaa
catctgcggttagcggtttgctattggcacaccttctgctggacgggtaacgatatgttt
ggcgtgggttcgcttgacagaagctggcaaaaaacgggggatttactgcaaggtgcgaag
caaaaagcggaaattgcctttgaatttttccaaaaattaggcattccttactactgcttc
cacgatgtggatgttgcaccggaaggcaacaatttcaaagaatatcagcacaatttcaac
actattgtggatattttagagcaaaaacaagctgaaacaggcgtgaaattattatggggt
acggcgaactgctttaccaatcctcgctatatgtcgggtgcttcaaccaatccgaatccg
gaagtctttgcttgggcggcagcacaagtctttaccgcaatgaacgcaaccaaacgctta
ggcggcgaaaattatgtattatggggcggacgtgaaggttatgaaaccctactcaacact
gacttaaaacgtgagcgtgaacaaatcggtcgctttatgcagttagtggtggaacataaa
cacaaaatcggttttaacggcactttattaattgagccaaaaccacaagaaccaaccaaa
catcaatatgactacgatgttgccaccgtttacggtttcttaaaacagtttggtctagaa
aaagagatcaaagtcaacattgaagcaaaccacgccactcttgcagggcatactttccaa
cacgaaattgcgactgccaccgcattagatatttttggctcgattgatgccaaccgaggt
gatccgcaattaggttgggataccgaccaattcccaaacagcgtggaagaaaacaccctt
gtgatgtatgaaatcttaaaagcaggtggtttcacaacgggcggtttcaactttgatgcg
aaaatccgccgccaaagtaccgatccgtatgatttattccacgcacatatcggggcaatt
gatgtgttagccctttcgctaaaacgtgcggcaaaaatgctggaagatcaagcattacag
aaagtagtagataaccgctacgctggctggaaccaagatttgggcttacaaattctaaac
ggtaaagcaagccttgaagatttggcaaaaatagtggaaacccaagggttagatccaaaa
cctgtttccggtcagcaagaatatttggaaaatttggtaaatagctatatttaccgttaa

DBGET integrated database retrieval system