KEGG   Mannheimia haemolytica M42548: MHH_c10480Help
Entry
MHH_c10480        CDS       T02635                                 

Gene name
ligA1
Definition
DNA ligase LigA (EC:6.5.1.1)
Orthology
K01971  
DNA ligase (ATP) [EC:6.5.1.1]
Organism
mhx  Mannheimia haemolytica M42548
Pathway
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:mhx00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    MHH_c10480 (ligA1)
   03420 Nucleotide excision repair
    MHH_c10480 (ligA1)
   03430 Mismatch repair
    MHH_c10480 (ligA1)
   03450 Non-homologous end-joining
    MHH_c10480 (ligA1)
Enzymes [BR:mhx01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MHH_c10480 (ligA1)
DNA repair and recombination proteins [BR:mhx03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MHH_c10480 (ligA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1000024..1000848)
Genome map
AA seq 274 aa AA seqDB search
MKKLLLFLLFIGNPIFAKSPELMLVEQYQDQDISGWVMSEKLDGVRGFWDGQQLISRQGY
PLNPPDYFIQDFPPFAIDGELFSERGKFEEISSIVRSAQPKGWHKLKLQVFDVPNAQGNL
IERLATLENYLKQHPTLHIAIIEQIPIKDKAHLQQFYQSVLEQGGEGVIVRNPNAGYIQG
RSAQILKIKPVLDEECTVVAHHKGKGKYTDKLGAITCENQRGRFRIGSGFKDKERENPPP
IGSIITYKYRGVTESGKPRFATFWRIRNDQISEN
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactgctcttattcctactcttcattggtaaccctatttttgccaaatcgccc
gagttaatgctcgttgagcaatatcaagatcaagacatcagtggctgggtaatgtcagaa
aaactcgatggcgtgcgaggcttttgggacggtcaacagctcatcagccgccaaggttat
ccgctcaatccacccgactattttattcaagatttccctccttttgcgattgacggcgaa
ctgtttagcgaacggggcaaatttgaggaaatttcaagcattgtgcgttccgctcagccc
aaaggttggcacaagctgaaattacaggtgttcgatgtgccaaatgcacaagggaatttg
attgaacggctggcgaccttagagaattatctgaagcaacatccaacgctccatatcgct
attattgagcaaattccgattaaagataaagcccaccttcaacaattttaccaatctgtg
ctggaacaaggtggcgaaggggttatcgttcgcaacccgaatgcaggctatattcaaggt
cgttctgcccaaattttgaaaatcaaaccggttttagatgaggaatgcactgtggttgcc
catcataaaggcaaagggaaatataccgataaactcggggcaatcacttgtgaaaatcaa
cgtggacgttttcggattggcagcggttttaaagataaagaacgagaaaatccgccaccg
attggctcaatcattacctataaatatcgaggtgtcacagaatcaggcaagcccagattt
gcaacgttttggcgaataagaaatgatcaaatttctgaaaattaa

DBGET integrated database retrieval system