KEGG   Mannheimia haemolytica M42548: MHH_c10480Help
Entry
MHH_c10480        CDS       T02635                                 

Gene name
ligA1
Definition
DNA ligase LigA (EC:6.5.1.1)
Orthology
K01971  
DNA ligase (ATP) [EC:6.5.1.1]
Organism
mhx  Mannheimia haemolytica M42548
Pathway
Base excision repair
Nucleotide excision repair
Mismatch repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mhx03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:mhx03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:mhx03430]
Genetic Information Processing; Replication and repair; Non-homologous end-joining
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1000024..1000848)
Genome map
AA seq 274 aa AA seqDB search
MKKLLLFLLFIGNPIFAKSPELMLVEQYQDQDISGWVMSEKLDGVRGFWDGQQLISRQGY
PLNPPDYFIQDFPPFAIDGELFSERGKFEEISSIVRSAQPKGWHKLKLQVFDVPNAQGNL
IERLATLENYLKQHPTLHIAIIEQIPIKDKAHLQQFYQSVLEQGGEGVIVRNPNAGYIQG
RSAQILKIKPVLDEECTVVAHHKGKGKYTDKLGAITCENQRGRFRIGSGFKDKERENPPP
IGSIITYKYRGVTESGKPRFATFWRIRNDQISEN
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactgctcttattcctactcttcattggtaaccctatttttgccaaatcgccc
gagttaatgctcgttgagcaatatcaagatcaagacatcagtggctgggtaatgtcagaa
aaactcgatggcgtgcgaggcttttgggacggtcaacagctcatcagccgccaaggttat
ccgctcaatccacccgactattttattcaagatttccctccttttgcgattgacggcgaa
ctgtttagcgaacggggcaaatttgaggaaatttcaagcattgtgcgttccgctcagccc
aaaggttggcacaagctgaaattacaggtgttcgatgtgccaaatgcacaagggaatttg
attgaacggctggcgaccttagagaattatctgaagcaacatccaacgctccatatcgct
attattgagcaaattccgattaaagataaagcccaccttcaacaattttaccaatctgtg
ctggaacaaggtggcgaaggggttatcgttcgcaacccgaatgcaggctatattcaaggt
cgttctgcccaaattttgaaaatcaaaccggttttagatgaggaatgcactgtggttgcc
catcataaaggcaaagggaaatataccgataaactcggggcaatcacttgtgaaaatcaa
cgtggacgttttcggattggcagcggttttaaagataaagaacgagaaaatccgccaccg
attggctcaatcattacctataaatatcgaggtgtcacagaatcaggcaagcccagattt
gcaacgttttggcgaataagaaatgatcaaatttctgaaaattaa

DBGET integrated database retrieval system