KEGG   Mannheimia haemolytica M42548: MHH_c16270Help
Entry
MHH_c16270        CDS       T02635                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching enzyme GlgB (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mhx  Mannheimia haemolytica M42548
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:mhx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MHH_c16270 (glgB)
Enzymes [BR:mhx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     MHH_c16270 (glgB)
Exosome [BR:mhx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MHH_c16270 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1549355..1551577
Genome map
AA seq 740 aa AA seqDB search
MQDYTYSEKDAFFVERLSSGSCNDPFSYLGIHPSNNGVIIRVFLPSAIACQVIDLNGKPV
SSMLKIDDRGFFIAELIGKKTDFSYRLLVEYPDSTVDIEDPYRFKTHIQELDNWLFAEGK
QLRPYEKLGAHLVTQNEVGGVHFSVWAPNAQRVSVVGDFNHWNGLVHSMRFHPDSGIWDI
FLPNVKKGECYKFEVLDRNGVLRLKSDPYAFASQFRPETASIVSGLPSIVPAEKTCRNAN
APDKPISIYEVHLGSWRRNIENNYWLSYEELADELIPYVKDMGFTHIELLPISEFPFDGS
WGYQTTGIYSPTSRFGTPEGLSYFIQKAHDKGIGVILDWVVGHFPVDEHGLVYFDGTHLY
EHSDPKEGYHKDWNTLIFSYGRNEVSNYLSGNALYWIERFGIDALRVDAVASMIYRDYSR
SDGEWIPNKYGGRENLEAIDFLRHTNNILRDESQGGASIAEESTSFAGVSHSTERGGLGF
NYKWNMGWMNDTLRYMQKDPIYRRYHHNLMTFGMTYQYSEQFVLPLSHDEVVHGKGSLLN
KMPGDCWQKFANLRAYYGYMWGYPGKKLLFMGNEFAQGKEWNFAESLDWYLLGEEGGEWH
KGVLGWVKALNHLYTQTPALFEQDYNPEGFEWLVVDDHDNSVFAFERKAKNGDSVIVVSN
FTPIVRENYRFGVNELAEYQEILNSDLACYCGSNVSNANRFASELIASHGKAYSLSITLP
PLSTIFLKRAADKKTKQNKT
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgcaagactatacttattctgaaaaagatgctttttttgttgagcgactttcttcgggt
tcttgtaatgatcctttctcctacctaggtattcaccctagcaataacggcgttattatt
agggtatttcttccttctgccatagcttgccaagtgatcgatttaaacggaaagcctgtg
tcatcaatgctaaaaattgatgatagaggcttttttattgcagagctgattggtaaaaaa
acagatttttcttaccgcttgttggtggaataccctgattcaacggtggatatagaagac
ccttaccgttttaaaacccatattcaagagcttgataattggttgtttgcggaaggaaaa
caacttcgcccgtacgaaaaattaggcgcacatttagtcacacaaaatgaagttgggggt
gtgcattttagcgtctgggcgccgaacgctcagcgggtttccgtggttggggatttcaac
cactggaacggcttggtacattcaatgcgattccaccccgattccggtatttgggatatt
ttcctgccgaatgtgaaaaaaggggagtgctataaatttgaagtgttggatcgaaacggc
gtgctacggttgaaatccgacccttacgcctttgcctcccaattccgcccagaaaccgca
tctattgtttccggcttgccaagcattgtgccagccgagaaaacctgccgtaatgcgaat
gctcccgataaaccgatttccatttatgaagtgcatttaggctcttggcgacgcaacatt
gaaaacaattattggcttagctatgaagagcttgccgatgaactcattccttatgtgaaa
gatatgggctttacccatattgaattgctgcctatttccgaatttccgtttgatggctct
tggggttatcaaaccaccggtatttattcgccaaccagccgttttggtacgcctgagggc
ttgagttactttatccaaaaagctcacgataaaggcattggtgtgattcttgactgggta
gtggggcattttccggtagatgaacacggcttggtttattttgatggaacgcatttatac
gaacattccgatccgaaagagggctaccacaaagattggaataccttaatttttagctac
ggcagaaatgaggtgagcaattatttgtctggtaatgcactttattggattgagcgtttt
gggattgatgcgttgcgggtggatgcggtggcgtcaatgatttatcgtgattactcacgt
tcagacggcgagtggattccaaataaatatggcggacgtgagaacttagaggcaatcgac
ttcttacgccacaccaataatattttgagagacgaaagccaaggcggtgcgagcattgca
gaggagtccacttcttttgccggagtgtctcactcaactgaaagaggcggtttgggcttt
aattataaatggaatatgggctggatgaacgacactttacgctatatgcaaaaagatcca
atttaccgccgttatcaccacaatttaatgacttttggtatgacctaccaatacagcgaa
cagtttgtgttaccgctttcacacgatgaagttgttcacggcaaaggttcattgctgaat
aaaatgccgggggattgctggcaaaaatttgcgaacttacgagcctattatggctatatg
tggggctatccgggcaaaaaattgctctttatgggcaacgagtttgctcaaggtaaagag
tggaattttgccgagagcttagattggtatttactcggggaagaagggggcgaatggcat
aagggcgtattgggttgggtaaaagcccttaaccatttatacacccaaacccctgcactg
tttgagcaagattacaatcctgaaggttttgagtggttagtggtggacgatcacgataat
tcggtgtttgcttttgagcgtaaagccaaaaatggcgattcggtgattgtggtgagtaat
ttcaccccgattgtgcgtgaaaattaccgttttggggtgaatgaattggcagaatatcag
gaaattctcaattctgatttagcttgttattgcggtagtaatgtcagcaatgcaaaccga
tttgccagcgagttaattgcatcgcacggtaaagcctactccttgagcattactttgcca
ccgctatcgactatcttcctcaaaagagccgcagacaaaaaaacaaaacaaaacaaaaca
taa

DBGET integrated database retrieval system