KEGG   Mannheimia haemolytica M42548: MHH_c17870Help
Entry
MHH_c17870        CDS       T02635                                 

Definition
phage-like lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
mhx  Mannheimia haemolytica M42548
Brite
Enzymes [BR:mhx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     MHH_c17870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1677727..1678296
Genome map
AA seq 189 aa AA seqDB search
MSKSLKYGSGIVCGIAAIITLVQYQHPEIRTNQAGLEIIGNAEGCRRDPYKCPADVITVG
IGSTEFGGEKIDPNRIYSDKEIAERWAKDLKIAESCVNRHFNGKDMNDNQFSGMTSAVFN
MGCYNMRFYRNKQGQYVQTTIHKLAVNKQFEEMCHRLPDFIRASGKVLNGLVIRREKEKA
LCLTGLVAR
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaagccttaaatatggcagtggtatcgtttgtggtatcgctgccattattaca
ttagtccaatatcaacatcccgaaatccgcactaaccaagctggattagagattatcggt
aatgctgagggttgcagacgtgatccgtataaatgccctgccgatgtaatcacggttggc
attggctcaacggagtttggcggtgaaaagattgacccaaatcgtatttattctgacaaa
gaaattgctgagcgttgggcaaaagatttgaagattgcggagagttgtgtcaatcgtcat
tttaatggtaaagacatgaacgataatcaattttcgggaatgacgtccgctgtatttaat
atgggttgttataacatgagattttatcggaataaacaaggtcaatatgtgcagactacc
atccataaactcgcagtgaataaacaatttgaggagatgtgtcatcgactacctgacttt
attcgtgccagtggtaaggtattgaacggattggttatccgccgtgaaaaggagaaagca
ttatgcttaactggattagtggcacgatag

DBGET integrated database retrieval system