KEGG   Mannheimia haemolytica M42548: MHH_c18330Help
Entry
MHH_c18330        CDS       T02635                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
mhx  Mannheimia haemolytica M42548
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1719837..1720520
Genome map
AA seq 227 aa AA seqDB search
MKKNLITLGLMCLSTITFASDAKLKSQLEKIGATDVKISDSPLTGFKMATSNEGVVYISQ
DGRYVIQGKVFELKNGKAIDITNQGLLAELNSYTNEMIVYPAKNEKHVITVFMDITCHYC
HLLHTKIKEYNDLGITIRYLAFPRGGMNTQTAKQMEAIWTSADKVKALNDAEDGKLPTQI
KTPDIVKKHYQLGIKFGVTGTPNMVTSEGELIGGYVEPKELAKMLSE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaatctaatcactttaggattaatgtgtttatcaaccatcacgtttgcttca
gatgcaaaactaaaaagccagcttgaaaaaattggagccacagatgttaaaatttcagat
tctccattaacaggctttaaaatggcgacttcaaatgaaggtgttgtatatatcagccaa
gacggtcgttatgtaattcaaggtaaagtatttgagctaaaaaatggtaaagcgattgat
attactaatcaaggattgttggcagaattgaattcatacactaatgaaatgatcgtatat
ccagcgaaaaatgagaaacatgtgattacggtgtttatggatattacttgccattattgc
catttactacatactaaaatcaaagaatataatgatttaggtattaccattcgctatttg
gcattcccgcgtggtggaatgaatacccaaacagcaaaacaaatggaagctatttggaca
tcagcagacaaagtaaaagcactgaatgatgctgaagatggtaaattaccaacccaaata
aaaacgccggatattgtgaaaaaacattaccaattagggattaaatttggtgtgacaggt
accccaaatatggtaacttcagaaggtgagttgattggtggttatgtagagcctaaagaa
ttagcgaaaatgttaagtgagtaa

DBGET integrated database retrieval system