KEGG   Mannheimia haemolytica M42548: MHH_c21130Help
Entry
MHH_c21130        CDS       T02635                                 

Gene name
gdhA
Definition
(GenBank) NADP-specific glutamate dehydrogenase GdhA
  KO
K00262  glutamate dehydrogenase (NADP+) [EC:1.4.1.4]
Organism
mhx  Mannheimia haemolytica M42548
Pathway
mhx00220  Arginine biosynthesis
mhx00250  Alanine, aspartate and glutamate metabolism
mhx00910  Nitrogen metabolism
mhx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhx00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    MHH_c21130 (gdhA)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MHH_c21130 (gdhA)
   00220 Arginine biosynthesis
    MHH_c21130 (gdhA)
Enzymes [BR:mhx01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.4  glutamate dehydrogenase (NADP+)
     MHH_c21130 (gdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ELFV_dehydrog ELFV_dehydrog_N NAD_binding_7 2-Hacid_dh_C Tenui_NCP
Motif
Other DBs
NCBI-ProteinID: AGK02559
UniProt: M9X6Q7
Position
complement(1996358..1997698)
Genome map
AA seq 446 aa AA seqDB search
MSDLNALFQKIKQRDPNQAPFHQAVEEVFGSLAPFLAKNPKYTQQGLLGRIVEPERVISF
RVTWVDDKGQVQVNRGYRVQMNSAIGPYKGGIRFHPTVDLGVLKFLAFEQVFKNALTTLP
MGGGKGGSDFDPKGKSDAEVMRFCQAFMSELYRHIGADTDVPAGDIGVGGREIGYMFGQY
KKLRNEFTSVLTGKSLTWGGSLIRPEATGYGAVYFAESMLATKGQQIEGKSVVISGSGNV
AQYAAEKVIQKGGKVLTVSDSNGYVLFPESGMTEAQLQALLELKNERRERLSVYATEQGL
KYFDGQKPWGVKCDIALPCATQNELDTEDAKELVKNGCICVAEGANMPTTLGGVEVFIGA
KILYAPGKAANAGGVATSGLEMSQNAIRLSWSREEVDQRLFNIMKAIHENCVENGTEADG
FVNYVNGANIAGFKKVANAMLEQGIV
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatttaaacgcccttttccaaaaaatcaaacaacgtgatccgaaccaagcccct
ttccatcaagcggttgaagaagtgttcggtagccttgcccctttcttagctaaaaatccg
aaatatacccagcaaggtttattagggcgtattgttgagcctgagcgtgtaattagcttc
cgtgtcacttgggttgatgataaaggtcaagtgcaagtaaaccgtggttaccgtgtacaa
atgaactcagcaatcggtccatacaaaggcggtattcgtttccacccaaccgttgattta
ggcgtattaaaattcttagcctttgagcaagtattcaaaaatgcgttaacgacattgcca
atgggcggtggtaaaggtggttcagactttgacccgaaaggcaaatctgatgccgaagta
atgcgtttctgccaagcgtttatgagcgaattatatcgccacattggtgctgatactgac
gttcctgcaggcgatatcggcgtgggaggtcgtgaaatcggctatatgttcggtcaatac
aaaaaattacgcaatgaatttacttcagtattaaccggtaaatcgctgacttggggtggt
agcttaattcgtccggaagcaactggttatggtgcggtgtattttgcagagtctatgtta
gcgactaaaggtcagcagatcgaaggaaaatcagtggtaatttccggttcgggtaacgtg
gcacaatatgcagctgaaaaagtgattcaaaaaggcggtaaagtattaacggtttcagat
tctaacggttatgtcttattccctgaatccggtatgacagaggcacaattacaagcatta
ttagagttgaaaaacgaacgccgtgaacgcttatctgtgtatgcaacagaacaaggctta
aaatactttgacggtcaaaaaccgtggggtgtgaaatgtgacatcgctttaccttgtgca
acccaaaacgaattagataccgaagatgctaaagaattagtgaaaaacggctgtatttgt
gtggcagaaggtgcaaatatgccaaccacattaggtggtgttgaagtctttatcggtgcg
aaaatcctttatgctccgggtaaagcggctaacgcaggtggtgtggcaacctcaggttta
gaaatgagccaaaatgcaattcgtctatcttggagtcgtgaagaagtagatcagcgttta
ttcaacattatgaaagcaattcacgaaaactgcgtagaaaatggtactgaagcagatggt
ttcgtaaactatgtaaacggtgcgaatattgctggtttcaaaaaagtggcaaatgcgatg
ttagaacagggtattgtttaa

DBGET integrated database retrieval system