KEGG   Mannheimia haemolytica M42548: MHH_c21130Help
Entry
MHH_c21130        CDS       T02635                                 

Gene name
gdhA
Definition
NADP-specific glutamate dehydrogenase GdhA (EC:1.4.1.4)
Orthology
K00262  
glutamate dehydrogenase (NADP+) [EC:1.4.1.4]
Organism
mhx  Mannheimia haemolytica M42548
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:mhx00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mhx00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mhx00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1996358..1997698)
Genome map
AA seq 446 aa AA seqDB search
MSDLNALFQKIKQRDPNQAPFHQAVEEVFGSLAPFLAKNPKYTQQGLLGRIVEPERVISF
RVTWVDDKGQVQVNRGYRVQMNSAIGPYKGGIRFHPTVDLGVLKFLAFEQVFKNALTTLP
MGGGKGGSDFDPKGKSDAEVMRFCQAFMSELYRHIGADTDVPAGDIGVGGREIGYMFGQY
KKLRNEFTSVLTGKSLTWGGSLIRPEATGYGAVYFAESMLATKGQQIEGKSVVISGSGNV
AQYAAEKVIQKGGKVLTVSDSNGYVLFPESGMTEAQLQALLELKNERRERLSVYATEQGL
KYFDGQKPWGVKCDIALPCATQNELDTEDAKELVKNGCICVAEGANMPTTLGGVEVFIGA
KILYAPGKAANAGGVATSGLEMSQNAIRLSWSREEVDQRLFNIMKAIHENCVENGTEADG
FVNYVNGANIAGFKKVANAMLEQGIV
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatttaaacgcccttttccaaaaaatcaaacaacgtgatccgaaccaagcccct
ttccatcaagcggttgaagaagtgttcggtagccttgcccctttcttagctaaaaatccg
aaatatacccagcaaggtttattagggcgtattgttgagcctgagcgtgtaattagcttc
cgtgtcacttgggttgatgataaaggtcaagtgcaagtaaaccgtggttaccgtgtacaa
atgaactcagcaatcggtccatacaaaggcggtattcgtttccacccaaccgttgattta
ggcgtattaaaattcttagcctttgagcaagtattcaaaaatgcgttaacgacattgcca
atgggcggtggtaaaggtggttcagactttgacccgaaaggcaaatctgatgccgaagta
atgcgtttctgccaagcgtttatgagcgaattatatcgccacattggtgctgatactgac
gttcctgcaggcgatatcggcgtgggaggtcgtgaaatcggctatatgttcggtcaatac
aaaaaattacgcaatgaatttacttcagtattaaccggtaaatcgctgacttggggtggt
agcttaattcgtccggaagcaactggttatggtgcggtgtattttgcagagtctatgtta
gcgactaaaggtcagcagatcgaaggaaaatcagtggtaatttccggttcgggtaacgtg
gcacaatatgcagctgaaaaagtgattcaaaaaggcggtaaagtattaacggtttcagat
tctaacggttatgtcttattccctgaatccggtatgacagaggcacaattacaagcatta
ttagagttgaaaaacgaacgccgtgaacgcttatctgtgtatgcaacagaacaaggctta
aaatactttgacggtcaaaaaccgtggggtgtgaaatgtgacatcgctttaccttgtgca
acccaaaacgaattagataccgaagatgctaaagaattagtgaaaaacggctgtatttgt
gtggcagaaggtgcaaatatgccaaccacattaggtggtgttgaagtctttatcggtgcg
aaaatcctttatgctccgggtaaagcggctaacgcaggtggtgtggcaacctcaggttta
gaaatgagccaaaatgcaattcgtctatcttggagtcgtgaagaagtagatcagcgttta
ttcaacattatgaaagcaattcacgaaaactgcgtagaaaatggtactgaagcagatggt
ttcgtaaactatgtaaacggtgcgaatattgctggtttcaaaaaagtggcaaatgcgatg
ttagaacagggtattgtttaa

DBGET integrated database retrieval system