KEGG   Mannheimia haemolytica M42548: MHH_c21130Help
Entry
MHH_c21130        CDS       T02635                                 

Gene name
gdhA
Definition
NADP-specific glutamate dehydrogenase GdhA (EC:1.4.1.4)
Orthology
K00262  
glutamate dehydrogenase (NADP+) [EC:1.4.1.4]
Organism
mhx  Mannheimia haemolytica M42548
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhx00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    MHH_c21130 (gdhA)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MHH_c21130 (gdhA)
   00330 Arginine and proline metabolism
    MHH_c21130 (gdhA)
Enzymes [BR:mhx01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.4  glutamate dehydrogenase (NADP+)
     MHH_c21130 (gdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1996358..1997698)
Genome map
AA seq 446 aa AA seqDB search
MSDLNALFQKIKQRDPNQAPFHQAVEEVFGSLAPFLAKNPKYTQQGLLGRIVEPERVISF
RVTWVDDKGQVQVNRGYRVQMNSAIGPYKGGIRFHPTVDLGVLKFLAFEQVFKNALTTLP
MGGGKGGSDFDPKGKSDAEVMRFCQAFMSELYRHIGADTDVPAGDIGVGGREIGYMFGQY
KKLRNEFTSVLTGKSLTWGGSLIRPEATGYGAVYFAESMLATKGQQIEGKSVVISGSGNV
AQYAAEKVIQKGGKVLTVSDSNGYVLFPESGMTEAQLQALLELKNERRERLSVYATEQGL
KYFDGQKPWGVKCDIALPCATQNELDTEDAKELVKNGCICVAEGANMPTTLGGVEVFIGA
KILYAPGKAANAGGVATSGLEMSQNAIRLSWSREEVDQRLFNIMKAIHENCVENGTEADG
FVNYVNGANIAGFKKVANAMLEQGIV
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatttaaacgcccttttccaaaaaatcaaacaacgtgatccgaaccaagcccct
ttccatcaagcggttgaagaagtgttcggtagccttgcccctttcttagctaaaaatccg
aaatatacccagcaaggtttattagggcgtattgttgagcctgagcgtgtaattagcttc
cgtgtcacttgggttgatgataaaggtcaagtgcaagtaaaccgtggttaccgtgtacaa
atgaactcagcaatcggtccatacaaaggcggtattcgtttccacccaaccgttgattta
ggcgtattaaaattcttagcctttgagcaagtattcaaaaatgcgttaacgacattgcca
atgggcggtggtaaaggtggttcagactttgacccgaaaggcaaatctgatgccgaagta
atgcgtttctgccaagcgtttatgagcgaattatatcgccacattggtgctgatactgac
gttcctgcaggcgatatcggcgtgggaggtcgtgaaatcggctatatgttcggtcaatac
aaaaaattacgcaatgaatttacttcagtattaaccggtaaatcgctgacttggggtggt
agcttaattcgtccggaagcaactggttatggtgcggtgtattttgcagagtctatgtta
gcgactaaaggtcagcagatcgaaggaaaatcagtggtaatttccggttcgggtaacgtg
gcacaatatgcagctgaaaaagtgattcaaaaaggcggtaaagtattaacggtttcagat
tctaacggttatgtcttattccctgaatccggtatgacagaggcacaattacaagcatta
ttagagttgaaaaacgaacgccgtgaacgcttatctgtgtatgcaacagaacaaggctta
aaatactttgacggtcaaaaaccgtggggtgtgaaatgtgacatcgctttaccttgtgca
acccaaaacgaattagataccgaagatgctaaagaattagtgaaaaacggctgtatttgt
gtggcagaaggtgcaaatatgccaaccacattaggtggtgttgaagtctttatcggtgcg
aaaatcctttatgctccgggtaaagcggctaacgcaggtggtgtggcaacctcaggttta
gaaatgagccaaaatgcaattcgtctatcttggagtcgtgaagaagtagatcagcgttta
ttcaacattatgaaagcaattcacgaaaactgcgtagaaaatggtactgaagcagatggt
ttcgtaaactatgtaaacggtgcgaatattgctggtttcaaaaaagtggcaaatgcgatg
ttagaacagggtattgtttaa

DBGET integrated database retrieval system