KEGG   Mannheimia haemolytica M42548: MHH_c24100Help
Entry
MHH_c24100        CDS       T02635                                 

Definition
(GenBank) autotransporter adhesin
Organism
mhx  Mannheimia haemolytica M42548
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YadA_head
Motif
Other DBs
NCBI-ProteinID: AGK02848
UniProt: M9X8F8
Position
2285046..2287277
Genome map
AA seq 743 aa AA seqDB search
MPNFSFTHLYKKHTKELPTVTLLSALIGLSQVSYANPLPLGNTTGTNNLAVGEGSFALGT
GSQAIGKNAIATGGNISPQEFNVELENFRDLVNQIEELRTQIAEQEKQGSVNQQLQDALK
SQIAQYDTILERVREKQAQQAILANSVISMRKELVNRRNQLTELENNFNTSFLTGKNKQE
AYQKFSTVIESLDWDKLSKTNGVDQLATDLKTKIETDFPNINFSNEKYKDLIKGYSNIQG
NLVTAIPNFLEKVNNDFAISARNRDLYSHYLPYQGIDDWENSNFNFRTLNGVYYDDNLTS
TELLRKFMIQRDYNTLYALSSARTGNADSLAKNYHLVVAKMSYENLKKELSKKPDSTFNK
LKKLYETNGEFLNEYILDNFRGNPLELLTVPALKESLENQESFPSRLYQKFNIFNQAIAQ
TTSNITKEEIDDLEKTVENFNNFKNSIDYDSDAWIFNKEEYRTYMNDNVIPFMEKVEEFT
ETLKTLSRDDLSAEERTTKTIDSVKLRIYLNEQARNRKNYINGFVPTDWIPEITDQMTKS
KNLWLKYEEEAKTTLKPYQEETISRVIQDEINKKMAEIGTTTLEIGGKEHELEDLENQIN
ALALTDEEKLAEDVENDLISKLDEAKAALAKNQQTLKEKRDELLGLNNKLDSSPLVKKGK
NALAEGTNAFASGENAIAFGTDSQATGNNAIALGANSKANAESAIAIGKGAQALKEKALA
LGENAIANRASAIAIGDNHSSKL
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgccaaactttagtttcacccatctgtataaaaaacacacaaaagagctccctactgtt
accttgcttagcgctctgatagggcttagccaagtctcttatgccaatccacttccttta
ggcaacaccactggcaccaataaccttgctgtaggtgaaggtagttttgcgttaggcaca
ggttctcaagcaatcggcaagaatgccattgcaaccggtggtaatatctccccccaggaa
ttcaatgtggagttagaaaacttccgtgatttagttaatcaaattgaagagttacgtact
caaattgctgaacaagaaaaacaaggctctgttaatcaacaattacaagatgctttaaag
agtcagattgctcaatatgacactattttagagcgtgtacgtgaaaaacaagcacaacaa
gcaatattagccaatagtgttatatcaatgcggaaagaattagttaatagaagaaatcag
ttaacagaattggaaaataattttaatactagttttttaacaggaaaaaataaacaagaa
gcatatcaaaaattttctacagtaatagaatcattagactgggataaattatcaaaaact
aatggggtagatcaattagcaacagacttaaaaactaaaattgaaactgatttccctaat
attaatttttcaaatgaaaaatataaagatctcattaaaggttatagcaatattcaaggt
aacttagtaacagccattcctaacttcctggagaaagttaataatgattttgctataagt
gctagaaatagagacttatatagtcactaccttccttatcagggtattgatgattgggag
aattctaattttaactttcgaacactaaatggagtttattatgatgataatctaacttca
acagaactcctgcgaaaatttatgattcaaagagattataacactctttatgctctaagt
tctgctcgcacaggaaatgctgatagtctggctaaaaattaccatcttgtagttgcgaaa
atgtcctatgaaaacctgaaaaaagaattatccaagaaacccgactctacatttaataaa
ctgaaaaagctgtatgaaaccaatggtgaattcttaaatgaatatattttagacaatttc
cgaggaaatccacttgaattattaacagtacctgcgcttaaagaaagtttagaaaaccaa
gagtcattccctagcaggctgtatcagaaatttaatattttcaaccaggctattgcacag
accacatcaaacattactaaagaagaaattgatgatttagaaaaaactgtagaaaatttc
aataacttcaaaaattcaattgattatgatagcgatgcgtggatctttaataaagaagaa
tatcgcacttatatgaatgataatgtaattccttttatggagaaggtagaggaatttact
gaaacattaaaaactttatctagagatgacttaagtgcagaggaacgtacaaccaaaaca
attgactccgttaaattaagaatatatctcaatgaacaagcacgaaatcgtaaaaattat
attaatggatttgtacctaccgattggattcctgaaattacagatcaaatgacaaaatcc
aaaaatctatggttaaaatatgaagaggaagccaaaacaacattaaaaccataccaagaa
gaaacaatatctagggttatacaagatgaaattaataaaaaaatggctgaaataggtact
acaacactagagattggtggtaaagaacacgagctcgaggatcttgaaaaccaaattaat
gctttagctttaactgatgaagaaaaacttgcggaagatgtggaaaatgatttaatctca
aagcttgatgaggctaaagcagccttagcaaaaaaccagcaaacgctcaaagaaaagcgt
gatgaattactagggctaaataacaaattagatagctcaccacttgttaaaaaaggtaaa
aatgcacttgcagaaggcacgaatgcctttgcttctggtgaaaatgccatcgcattcggc
acggattcacaagctacaggtaataacgctatcgcactaggtgcaaattcaaaagcaaac
gcagaaagtgcgattgcaattggtaaaggtgcacaagcattaaaagaaaaagcccttgct
ttaggcgaaaatgccattgccaacagagcatctgctattgcgattggtgataaccattca
tctaaattgtag

DBGET integrated database retrieval system