KEGG   Mannheimia haemolytica M42548: MHH_c24140Help
Entry
MHH_c24140        CDS       T02635                                 

Definition
(GenBank) putative membrane protein
  KO
K15977  
putative oxidoreductase
Organism
mhx  Mannheimia haemolytica M42548
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2289550..2290035
Genome map
AA seq 161 aa AA seqDB search
MSSFSSSFSTQSACSMTACKNGLGFLVLRLFLAYEFFEAGLSKLNGENWFASIQESFPFP
FNVLPADLSWAIASGAEILLPILLTLGLFTRFSALGLMILTAVAWYAVHAGNGYNVCNNG
YKMALIYLVMLVPLLLQGAGSLSLDFLLQKKSPTKRWLKFL
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcattttcgtcatcattttcaactcagtcagcttgctcaatgacagcttgtaaa
aacggcttgggctttcttgtattacgtctatttcttgcttatgaattttttgaagcaggg
ttatcaaaactaaacggtgaaaattggtttgcctcaattcaagagagcttcccattcccc
tttaacgtactaccagccgatcttagctgggctattgctagcggagcggaaatcttactg
cctattttactcactttgggtctgttcacccgcttcagtgcgttaggattaatgatctta
acagcggtagcgtggtatgctgttcacgctggcaatggctacaatgtctgcaacaatggc
tataaaatggcactcatttatttagtgatgttagtaccacttttattacaaggtgctggc
tcgctctctctcgattttctgttacagaaaaaatccccaaccaaacgctggttgaaattc
ctttaa

DBGET integrated database retrieval system