KEGG   Mannheimia haemolytica M42548: MHH_c24220Help
Entry
MHH_c24220        CDS       T02635                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase Ppc
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mhx  Mannheimia haemolytica M42548
Pathway
mhx00620  Pyruvate metabolism
mhx00680  Methane metabolism
mhx01100  Metabolic pathways
mhx01120  Microbial metabolism in diverse environments
mhx01200  Carbon metabolism
Module
mhx_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mhx00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MHH_c24220 (ppc)
  Energy metabolism
   00680 Methane metabolism
    MHH_c24220 (ppc)
Enzymes [BR:mhx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MHH_c24220 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AGK02860
UniProt: M9X410
Position
2294215..2296854
Genome map
AA seq 879 aa AA seqDB search
MNQQYSTIQHNIHMLGEFLGETIRDAQGNYILELIESIRVLSRNSRAGDENAREQLLDKL
ANISNDDVLPVARAFSHFLNLTNIAEQHQTVSRHHIDESLGSRSLDSLFLRLKSQNIPVE
KVIKTVESLMIDLVLTAHPTEVTRRSLGHKHVEINKCLNLLEHDDLTEAESYKIKRRLMQ
LIALAWHTNEIRTQRPTPVDEAKGGMAVIENSLWKAVPEFCRQLNFYLEKHFGVQYPVNL
APVRFSSWMGGDRDGNPFVTAETTRRVLRMNRWKATELFLQDIKNLAEELSITQCTPAFR
AKYGNHLEPYRVLLKVLRQKLINTEIYYAELLEGKISTIDESDILTSDQQLWEPLFDCYE
SLQACGMRIIANGALLDCLRRINCFGLGLSRLDIRQESTRHEMAIAEITRYIGLGDYAHW
TEDDKQAFLVRELSSRRPLIPTNWTPSPETKEVLDTCKIVAEQPEGVISAYVISMAREAS
DVLSVHLLLKEAGCKFTIPVAPLFETLGDLDHSEKVMTDLFNIGWYRGVINNYQMIMIGY
SDSAKDAGMLAAGWAQYRAQEALVNLCEKYNIELTLFHGRGGTIGRGGAPAHAALLSQPP
RSLKNGLRVTEQGEMIRFKLGLPAVAVESLELYASAILEANIFPPPEPKQQWRDVLAKAS
DISCQIYRDMVRGELDFVPYFRSATPEQELSRLPLGSRPAKRNPKGGVESLRAIPWIFAW
MQNRLMLPAWLGAGQALQQLIDEGNETLLKEMCNEWPFFSTRIGMLEMVFSKADIWLAEY
YDQRLVEPKLHRLGNMLRTQLQADLKTVLALAHDGQLMADLPWIAESIALRNIYTDPLNL
LQVELLDRIRKQGENADPVLEQALMITITGIAAGMRNTG
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagcaatattcaacaattcagcataatatccatatgttaggtgaatttttggga
gaaacgattcgtgatgcgcaaggaaattacattctagaactcatcgaaagcattcgtgtg
ttatctcgcaattctcgtgccggcgatgaaaacgcccgtgaacagctattagataaatta
gccaatatttctaacgatgatgtcttacccgttgcacgtgcatttagccattttctaaat
ctaacaaatattgctgaacaacatcaaactgtttctcgccatcatattgatgaatcactt
ggtagtcgctcattagactctctgttccttcgtctaaaatcacaaaatatccccgttgaa
aaagtgattaaaaccgtggaaagcctaatgattgatttagtgctaacagctcacccaacg
gaagtaacccgccgttcgctggggcataaacacgttgaaatcaataaatgtttgaatttg
ttggaacatgatgatttaactgaggcagaaagctataaaatcaagcgccgtttaatgcaa
ctgattgcccttgcttggcatactaatgaaatcagaacccaacgcccaacccctgttgat
gaagccaaaggcggtatggcagtcattgaaaatagtttatggaaagccgtgccggaattt
tgccgtcagcttaacttctatttagaaaaacactttggtgtgcaatatccggtaaattta
gcccctgtccgtttttcttcttggatgggcggagaccgtgacggtaacccgttcgtcacg
gcagaaacaactcgccgtgtattaagaatgaaccgttggaaagccacggaattgttctta
caagatattaaaaatcttgctgaagaattatcgattacacagtgtacccctgcatttcgt
gctaaatatggcaaccatttagagccatatcgcgtattactaaaagtattacgccagaaa
ttaattaataccgaaatttactatgcggaattattggaaggtaaaatttcaactattgat
gaaagtgacattttaacttcagatcagcaattgtgggaaccgctttttgattgctatgag
tcattacaagcctgtggtatgcgaattattgcaaatggtgcattactagattgcttacgt
cgtataaactgttttggtttaggtttatcacgcttagatattcgccaagaaagtacccgc
cacgaaatggcgattgcagaaattacccgctatatcggcttaggcgattatgctcactgg
acggaagatgataaacaggcattcttagtgcgtgaactcagttctcgccgcccattgatt
ccaaccaactggactccaagccctgaaactaaagaagtgttagacacttgtaaaattgtt
gccgagcaacctgaaggtgtcatttcagcctatgtcatttcaatggcaagagaggcctct
gatgtactctcggttcaccttttactcaaagaggcggggtgcaaatttactattccggtt
gccccattatttgaaacgctaggcgatttagatcatagtgaaaaagtgatgaccgattta
tttaatatcggctggtatcgtggcgtcatcaacaattaccaaatgattatgatcggctac
tctgattccgccaaagatgccggaatgcttgctgccggctgggcgcaatatcgggcgcaa
gaagctctggttaatttatgtgaaaaatataatattgaattaaccttattccacggtcgt
ggtggtactatcgggcgtggtggcgcaccggctcacgcagccttactttctcagccacct
cgctcactcaaaaatggcttacgagtgaccgaacaaggagaaatgatccgctttaaatta
ggcttacctgccgtggcagttgaaagtttagaactctatgccagtgcgattttagaagcg
aatattttcccaccaccggagccaaagcagcaatggcgagatgtgctagcaaaagcctcc
gatatttcttgccaaatttaccgtgatatggtgcgtggcgagctagacttcgtaccgtat
ttccgctctgctacaccagagcaagaactttcccgtctgccgcttggctcacgccctgca
aaacgtaatccaaaaggcggagtggagagtttgcgtgcaattccttggattttcgcttgg
atgcaaaaccgcttaatgctacctgcttggttaggtgcagggcaagcattgcaacagttg
attgatgaaggtaatgaaaccttactaaaagaaatgtgtaacgaatggccgtttttctcg
acccgtatcggaatgctggaaatggtatttagtaaagctgatatttggctggcggaatat
tacgaccaacgcctagtcgagccaaaactacaccgtttaggcaatatgttgcgtacgcaa
ctacaggctgatcttaaaaccgtacttgcactggctcacgatggacaattaatggccgat
ttaccttggatcgcagaatcgattgcactacgcaatatttataccgatccgctcaatcta
cttcaggtagaattgttagataggattcgcaaacaaggtgaaaatgctgatcctgtacta
gagcaagcattgatgatcaccatcacaggtattgccgcaggtatgcgaaatacaggttaa

DBGET integrated database retrieval system