KEGG   Mannheimia haemolytica M42548: MHH_c24270Help
Entry
MHH_c24270        CDS       T02635                                 

Definition
(GenBank) hypothetical protein UPF0231
  KO
K09910  
uncharacterized protein
Organism
mhx  Mannheimia haemolytica M42548
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2301927..2302304)
Genome map
AA seq 125 aa AA seqDB search
MEYQFTHSIHGVVAKCSMDHEAFARWLNAEITENPSQLAPIFAEIEKCRAAFPNHYECVF
EGREYSLYFDYDEVMAKANNLDAAFDDEEMEEGFQFYNEESIAFCGLDDFEKFLKAYQHF
VQTYH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggaatatcaatttacccatagtattcacggggtggtggcaaaatgttcgatggatcac
gaggcgtttgctcgttggttgaatgccgaaataacggaaaatcctagccagttagcccct
attttcgctgaaatagagaagtgtcgagccgcatttccgaatcattatgaatgtgtgttt
gaagggcgggagtatagtctctattttgattatgatgaagtgatggcaaaagcaaacaat
ttagatgctgcttttgatgatgaggaaatggaagaaggctttcaattttacaatgaagag
agcatcgcattttgtggcttagatgactttgagaaatttttgaaagcctaccaacatttt
gtgcaaacttatcattga

DBGET integrated database retrieval system