KEGG   Mannheimia haemolytica M42548: MHH_c24300Help
Entry
MHH_c24300        CDS       T02635                                 

Definition
(GenBank) putative hsdS-like specificity determinant HindVIIP
  KO
K01154  type I restriction enzyme, S subunit [EC:3.1.21.3]
Organism
mhx  Mannheimia haemolytica M42548
Brite
Enzymes [BR:mhx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.3  type I site-specific deoxyribonuclease
     MHH_c24300
Prokaryotic defense system [BR:mhx02048]
 Restriction and modification system (R-M system)
  Type I R-M system
   MHH_c24300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methylase_S
Motif
Other DBs
NCBI-ProteinID: AGK02868
UniProt: M9X8I0
Position
2304306..2305634
Genome map
AA seq 442 aa AA seqDB search
MAFNQYVFSDIVELISEKIKIKDLKKENYISTDNMLPNFGGITLAENLPNSASCNRFAKK
DILFSNIRTYFKKVWLAEFSGGCSPDVLVMRSKNTDILLNEYLFLLIRSDDFINFTVISA
NGAKMPRGDKNAMKGFIFNIPSIEYQKKCIANYFAFDQKIQLNTQTNQTLEAIAQAIFKS
WFVDFDPVRAKAAALSEGKSEHEANLAAMSVICGKDTSELNDTEYKALWQIAEAFPSEFG
DEGLPIGWKFNQADNLFDVGIGKTPPRKESEWFSDNANDTEWISIKDMGNQGLFITESSE
YLKAEAVDTFNIKRIPENTVILSFKLTVGRVSITTKETTTNEAIAHFKIPSSSNLSSEFL
YCYLKNFDFNNLGSTSSIATAVNSKMIKEMEILEPSVLVINHFNEYIEGIFNKIKENIIQ
NNNLSKIRDKLLPKLLSGEMEL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggcatttaatcagtatgtattttcagatattgttgaattaatatccgaaaaaataaaa
atcaaagacttaaaaaaagaaaactatatttcgacagataatatgctgcctaattttggt
ggaataacacttgctgaaaaccttccaaattcagcttcttgcaataggtttgccaaaaaa
gacattttgttttccaatataagaacctactttaaaaaagtttggcttgctgaattttca
ggtggttgttctcctgatgttctggtaatgcgcagtaaaaacacagatattttattaaat
gagtatttatttttacttatccgttctgatgattttattaactttacagttatatcagca
aatggagcaaaaatgccacgaggggataaaaatgcaatgaaaggttttattttcaatatc
ccaagtattgaatatcaaaaaaaatgtattgctaattattttgcctttgaccaaaaaatc
caactcaacacccaaaccaaccaaaccctagaagccattgcacaggcaatcttcaaaagc
tggtttgtggattttgaccctgtgcgcgccaaagccgccgccctaagcgaaggcaaaagc
gaacacgaagccaaccttgcggcaatgtcggtgatttgtggtaaagacaccagcgagtta
aacgacaccgaatacaaagcgctttggcaaatcgccgaagccttcccaagtgagtttgga
gatgaagggttacctattggctggaaattcaatcaagcagacaatttatttgatgttggt
attgggaaaaccccaccaagaaaagagagtgaatggttttctgataatgcaaatgataca
gaatggatttctattaaagatatgggaaatcagggattatttatcacagaaagtagcgaa
tatctaaaagctgaagccgtagatacatttaatattaaaagaattcctgaaaatactgta
attttgagttttaaattaaccgttggtagagtttcaattacgacaaaagaaacaactact
aacgaagctattgctcattttaaaattcctagctcatcaaatctaagctcagagttttta
tactgctacttaaaaaattttgattttaataatctaggaagtacatcatcaatcgcaacg
gcagtcaattcaaaaatgataaaagagatggaaattttagaaccatcagttctagttatt
aatcactttaatgaatatattgaaggtatttttaataagataaaagaaaatattattcaa
aataataacttatctaaaattagagataagttattacctaaattattaagtggggagatg
gagttgtga

DBGET integrated database retrieval system