KEGG   Mannheimia haemolytica M42548: MHH_c24320Help
Entry
MHH_c24320        CDS       T02635                                 

Gene name
glnE
Definition
(GenBank) glutamate-ammonia-ligase adenylyltransferase GlnE
  KO
K00982  
[glutamine synthetase] adenylyltransferase / [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase [EC:2.7.7.42 2.7.7.89]
Organism
mhx  Mannheimia haemolytica M42548
Brite
Enzymes [BR:mhx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.42  [glutamine synthetase] adenylyltransferase
     MHH_c24320 (glnE)
    2.7.7.89  [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase
     MHH_c24320 (glnE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2308826..2311717)
Genome map
AA seq 963 aa AA seqDB search
MLTTLIPLSQLNLPPNLQNSEQIQPLVTAISLSNFVHQTLQKQPDLLAEWLAKFPTPDDC
CNYTERLAKILARVENEEMLGRVLRQFRHRELARLSFIQSNKLATVELVFQHLSDLAESL
ILAARDWLFQRCCAEYGTPKNTLGETQELLILGMGKLGGRELNFSSDIDLIFTYPDIGET
EGGRKSIENSKFFTRMGQRLIKVLDEITADGFVYRTDMRLRPFGDSGALVLSFTAMEDYY
QEQGRDWERYAMIKAKILGEDSQNLNHRYLKQMLRPFVYRRYLDFSAIQSLREMKEKISR
EVVRRNLTDNIKFGAGGIREVEFIAQTFQMIRGGRDKILQERSLLKVLPRLAELNLLTQT
QVETLHNAYIFYRQIENVLQAIDDKQTQTLPTDEASQARLVFACQSYYQQDLYSEKTHWV
EHSFNDWQQFMAVLSQYQQAVRQIFNEIIGEEETQANCNPVNEKLAEWKDILHYNIRLED
LSAVLKGYPKVAENDYTEIFRHFSTTFQDWVKRPIGVRGREVLRNLMPRIADSIFKGEDH
LLLLPRVLNIVDKITTRTTYLELMLEKEQILPQLLALCSKSVMIAEQIARYPMLLDELMS
HRGLTDVQAFEKYQSALQDYLIRIPEEDEEALIDGLRQFKQTQILRIAAADILGVLLVMK
ISDHLTYLAEAIINAVVNMAWKQVSQRFGVPEHLEADEKGFAVIGYGKLGGIELGYNSDL
DLVFLHNAPEDSQTVGGKKEISSHQFYLKLAQKINSIFNLNTSAGVLYEVDMRLRPSGEA
GLLVSTFNAYEHYQKNEAWTWESQALVRTRCVFGAENLKQAFEKIRQSTLAQPRASGQLR
QEICEMRQKMYQHLSSHSAEQFHIKQDQGGITDIEFIAQYLVLAHSHQHPKMAVWSDNVR
IFDSAVECGILSSEQSEQLQHCYTALRNKIHHLNLLRKDSVVDASEFTTERAFVREMWQR
LLA
NT seq 2892 nt NT seq  +upstreamnt  +downstreamnt
atgcttaccaccctaattcccttatcccaactcaatttaccgcccaatttgcaaaattct
gagcaaattcaaccgcttgtgacggcgatttcgctttccaatttcgtgcatcaaaccttg
caaaaacagccggatttactggcagaatggcttgccaagtttcctacgcctgatgattgc
tgcaattatactgagcgtttagcaaaaatattagcaagagtggaaaatgaagaaatgttg
gggagggttttgcggcaatttcgccaccgtgaattggctcgtctgagctttattcagtca
aataaattagcgacggtagaattggtatttcagcatttgtcggatttagccgagagcctg
attctagccgctcgagattggttgtttcagcgttgctgtgccgaatatggcacgccaaag
aacactcttggcgaaacacaagaactgctgattttaggtatgggcaaattgggcggacga
gagcttaatttttcttccgatattgacctgatttttacctaccccgatattggtgaaacc
gaaggtggacgcaaatcgattgaaaacagcaaattttttacccgaatggggcagcggtta
attaaagtattagatgagatcaccgctgatggtttcgtgtatcgtaccgatatgcgactt
cgcccctttggtgatagcggagccttggtgctgagttttactgcaatggaagattattac
caagagcaagggcgtgattgggaacgttatgcgatgattaaagcaaaaattttaggcgag
gatagccaaaatttaaatcatcgctatttaaagcaaatgctccgcccttttgtttaccgc
cgttatctggatttcagtgcaatccaatcgttgcgtgaaatgaaagaaaaaatcagccgt
gaagtggttcgccgtaatttaaccgataatattaaatttggtgccggtgggattcgggaa
gtggagtttatcgcccaaactttccaaatgatccgtggcgggcgagataaaattttacaa
gaacgtagcctgttaaaagtgctaccacgcttggcagaattaaatttattaacccaaacg
caggtggaaacgctccacaatgcctatattttttaccgtcaaattgaaaatgtattacaa
gcgattgacgataaacaaactcaaaccctacccactgatgaagcctcgcaagcccgcctt
gtatttgcttgccaaagctattatcagcaagatctatatagcgaaaaaacgcattgggtg
gagcattcctttaacgattggcaacaatttatggcagtattgagccaatatcaacaagca
gtacgccagatttttaatgaaattatcggtgaagaggaaacacaagccaactgcaatccg
gttaatgaaaaattagccgaatggaaagacattttgcactataacattcgccttgaagat
ttatccgcagtgctaaaaggttatccaaaggttgcagaaaatgattatacggagattttc
cgtcacttttctactacctttcaagattgggtaaaacgcccgattggggtaagagggcga
gaggtgctacgcaatttaatgcctagaattgccgacagcatttttaaaggtgaagatcat
ttattgttattgcctcgcgtgttgaatattgtcgataaaatcaccacccgaactacctat
ttggaattaatgctcgaaaaagagcagattctgcctcaacttttagcattgtgtagtaag
tcggttatgattgcggaacagatagctcgatatccaatgctacttgatgagctgatgagc
catagaggcttaaccgacgtgcaggcttttgaaaaatatcaatctgccttgcaggattat
ttaatccgcattcctgaagaagatgaagaagcactgattgatggcttacgtcagttcaaa
caaacccaaattttacgcatcgccgctgctgatattttaggcgtgctgctggtaatgaag
atcagcgatcatcttacttacttagcagaagcgattattaatgcggtggtaaatatggcg
tggaagcaagtcagccaacgctttggtgtgccggaacatttagaggctgatgaaaaaggg
tttgcagttattggctacggcaagctaggcgggattgaactgggctataattcagatctc
gacttggttttcttgcataatgccccagaggatagccaaactgttggcggtaaaaaagag
atttcaagccatcaattttacttaaaattggctcaaaaaattaactcgatttttaacctt
aataccagtgccggcgtactatatgaagtggatatgcgacttcgcccatcaggcgaggct
gggcttttagtcagcactttcaatgcctacgagcattatcaaaaaaatgaagcgtggacg
tgggaaagccaagccctcgtgcggacaagatgtgtatttggggcggaaaacctcaaacaa
gcctttgaaaaaatccgccaaagcacgcttgctcagcctcgtgcaagcggtcaattacgc
caagaaatttgcgaaatgcgacagaaaatgtaccaacatttaagctcgcattcagccgag
caatttcatattaaacaagatcaaggaggtattaccgatattgaatttatcgcccaatat
ttggtattagcccacagccaccaacacccgaaaatggcagtatggtcggataatgtccga
attttcgacagcgcagtagaatgcggtattttaagttccgaacaaagcgaacagctacaa
cattgctacaccgcactgcgtaacaaaatccaccacctaaacttattacgcaaagacagc
gtggtggacgcaagtgaatttaccaccgagcgagcatttgtgcgggaaatgtggcagagg
ttattagcataa

DBGET integrated database retrieval system