KEGG   Mannheimia haemolytica M42548: MHH_c24330Help
Entry
MHH_c24330        CDS       T02635                                 

Gene name
yciL
Definition
(GenBank) putative enzyme YciL
  KO
K09780  
uncharacterized protein
Organism
mhx  Mannheimia haemolytica M42548
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2311889..2312170)
Genome map
AA seq 93 aa AA seqDB search
MYYVIFAQDNPNMLEKRLEVRPAHLARLEKLQAEGRLLIAGPNPTEDGSSVTGSTVIAEF
NSLEEAQQWASQDPYVEAGVYSDVIIKPFKRVF
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atgtattatgttatctttgcccaagataatcccaatatgttggaaaaacgtttagaagtt
cgcccggctcatttggctcgtttggaaaaattacaggcagaaggtcgattattaatcgca
gggcctaacccgactgaagacggctcaagcgtaaccggttcaactgtaattgcagagttc
aactcacttgaagaagctcaacaatgggcaagccaagatccttatgtggaagccggtgtg
tatagcgatgtgattattaaaccgtttaaaagagtgttttaa

DBGET integrated database retrieval system