KEGG   Mannheimia haemolytica M42548: MHH_c24340Help
Entry
MHH_c24340        CDS       T02635                                 

Gene name
yciA
Definition
(GenBank) acyl-CoA thioester hydrolase YciA
  KO
K10806  acyl-CoA thioesterase YciA [EC:3.1.2.-]
Organism
mhx  Mannheimia haemolytica M42548
Pathway
mhx01040  Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:mhx00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    MHH_c24340 (yciA)
Enzymes [BR:mhx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.-  
     MHH_c24340 (yciA)
Lipid biosynthesis proteins [BR:mhx01004]
 Fatty acid synthase
  Component type
   MHH_c24340 (yciA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 4HBT
Motif
Other DBs
NCBI-ProteinID: AGK02872
UniProt: M9X0M0
Position
complement(2312172..2312636)
Genome map
AA seq 154 aa AA seqDB search
MKDKPYGKAPEGKLILRTLAMPSDTNANGDIFGGWIMSQMDLGGAILAKELAKGRVVTVT
VDKMIFHRPISVGDVVCCYGKLMHIGRSSMQVKVEVFIKQVYEGNRERYLVTEALFTYVA
IDKEGKPRAVPRENNPELDEALSLIDLTPEKQGE
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgaaagataaaccctatggaaaagccccggaagggaaactgattttaagaactttggca
atgccgtcagatactaacgccaatggcgatattttcggcggttggattatgtcgcagatg
gatttaggcggtgcaattttagccaaagagttggcaaaaggtagagtcgttacggtaacg
gtagataaaatgattttccaccgcccgatttcagtcggtgatgtggtctgctgctacggc
aagttaatgcacatagggcgttcttcgatgcaagtgaaagtcgaggtctttatcaaacaa
gtttatgagggcaatcgcgaacgttatctcgtaaccgaagccttatttacctatgtagcg
attgataaagaaggcaaaccgcgtgctgtgccgagagaaaataaccccgaattagacgaa
gcattatcgctaattgatttaacccctgaaaaacaaggagaatag

DBGET integrated database retrieval system