KEGG   Mannheimia haemolytica M42548: MHH_c24390Help
Entry
MHH_c24390        CDS       T02635                                 

Definition
(GenBank) Nlp family transcripitonal regulator
  KO
K07724  Ner family transcriptional regulator
Organism
mhx  Mannheimia haemolytica M42548
Brite
Transcription factors [BR:mhx03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    MHH_c24390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_35 HTH_23
Motif
Other DBs
NCBI-ProteinID: AGK02877
UniProt: M9X0M5
Position
2315732..2315959
Genome map
AA seq 75 aa AA seqDB search
MNKKKRAQDMHRADIRAELMKKGITFSQLGIENGLSKTTVRNALDKPYKNGEEIIAKALG
KTPAEIWPSRYPDVA
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaagaaaagagctcaagatatgcatagagctgatattcgagctgaattgatg
aagaaaggaataacattttctcagttagggattgagaatgggctttccaaaacaacagta
agaaatgctcttgataaaccttataaaaacggtgaagaaattatcgcaaaagcattagga
aaaacgccagccgaaatatggcctagtcgttaccctgatgttgcataa

DBGET integrated database retrieval system