KEGG   Mannheimia haemolytica M42548: MHH_c24580Help
Entry
MHH_c24580        CDS       T02635                                 

Definition
(GenBank) hypothetical protein
Organism
mhx  Mannheimia haemolytica M42548
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2325389..2325544
Genome map
AA seq 51 aa AA seqDB search
MKLIKKLRQRWQQWRFYRRRPDLAELHNVVRAAVAQGNQHPVGRAKRGRYD
NT seq 156 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaattaaaaaactcagacagcgttggcaacaatggcgtttttatcgccgccgt
cctgaccttgcagaattgcataacgtggtgcgtgcggcggtggcacaaggtaatcaacac
ccggtcgggcgagccaaaagggggcgttatgattga

DBGET integrated database retrieval system