KEGG   Mannheimia haemolytica M42548: MHH_c24680Help
Entry
MHH_c24680        CDS       T02635                                 

Definition
(GenBank) Mu-like prophage major head protein gpT
Organism
mhx  Mannheimia haemolytica M42548
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mu-like_gpT
Motif
Other DBs
NCBI-ProteinID: AGK02906
UniProt: M9X2N5
Position
2333207..2334124
Genome map
AA seq 305 aa AA seqDB search
MFKKSELLKALDTAFRKEFSAGLKVLEPQWGTVAMKVSSSTATNTYAWLGQFPKMQEWVG
DRQIKNMQAQGMTIENKLFESTVAVPRTAIEDDQVGLFTPMVKQAAQSAAELPDDLVFSL
LKKGKTTLCYDGQNFFDTDHPVYQNVDGTGTSKTQSNITTGSASGKPAFYVLDDSQAIKP
LIWQERTTPEIETKFDPSESDHVFMKDQYLWGVRARGNAGFGFWQLIHRVEDSELNSETL
EKVLTAMRTLKGDGDKQLNIRPTTLLVPPSLEFAARKLLEAELIDGTTNTLKGVLKVVVN
PFIAE
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaatctgaattattaaaagcacttgatactgcatttcgtaaagaatttagt
gctggtttaaaagtgcttgaaccacaatggggaacggttgcaatgaaggtaagctccagc
accgctactaatacctatgcttggctgggacaattcccgaaaatgcaagagtgggtgggc
gaccgtcaaattaaaaatatgcaagcacaaggaatgacgattgagaataaattatttgaa
tcaaccgttgctgtgcctcgtactgccattgaagatgaccaagtgggcttatttacccca
atggtgaaacaagcggcacaaagtgcggctgaattacctgatgatttggtatttagtttg
ttgaaaaaaggtaagacaaccctttgctatgacgggcagaacttctttgataccgatcac
cctgtttatcagaatgttgatggaactggcacaagtaaaacacaaagtaatatcaccaca
ggctctgccagcggtaagcctgcgttctatgtgctagatgatagccaagccattaagccg
ttaatttggcaagaacgtactacacctgaaattgaaacgaagtttgatccaagtgagtca
gaccacgtctttatgaaagaccaatatttatggggtgtgcgtgctcgtggtaatgccggt
tttggtttctggcagttaattcaccgtgttgaagatagtgagttaaatagtgaaaccctt
gaaaaagtattaactgcaatgcgcaccttaaaaggcgatggcgataagcagttaaatatt
cgcccgaccactttgcttgtgccaccttcgcttgagtttgctgcacgcaaattactcgaa
gcagaattaattgacggcacaaccaacaccttaaaaggtgtgttaaaagtggtagtgaat
ccatttattgctgaataa

DBGET integrated database retrieval system