KEGG   Mannheimia haemolytica M42548: MHH_c24690Help
Entry
MHH_c24690        CDS       T02635                                 

Definition
(GenBank) hypothetical protein
Organism
mhx  Mannheimia haemolytica M42548
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AGK02907
UniProt: M9X0R0
Position
2334172..2334513
Genome map
AA seq 113 aa AA seqDB search
MAKPKKNDNEALNTNENTPLEDKVNEQPEDKTDEQPKPPESETKPDDGALINPIAFEVKL
KSIHPQATYGRCGYRFNKETAVEIARKALSDEQIITLANDPYLEFVPVVEGDA
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaccaaagaaaaatgacaatgaagctttgaacacaaacgaaaacacaccgctt
gaagataaggtgaatgaacagcctgaagataaaacggatgaacaacctaaaccgcctgaa
agtgaaactaagcctgatgacggtgctttgataaatcctattgcttttgaagttaagctc
aaatctatccacccacaagccacctatgggcgttgtggctaccgttttaataaagaaacg
gcggtagaaattgctcgtaaagccttgagtgatgaacaaattattaccttagccaacgac
ccttatttggagtttgtacctgttgttgagggcgatgcgtaa

DBGET integrated database retrieval system