KEGG   Mannheimia haemolytica M42548: MHH_c24710Help
Entry
MHH_c24710        CDS       T02635                                 

Definition
(GenBank) Mu-like prophage protein gp37
Organism
mhx  Mannheimia haemolytica M42548
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2334935..2335576
Genome map
AA seq 213 aa AA seqDB search
MISKIERALIERLTLGLGKMVYAVAGYAGEINDEKLDVLRLPACLVSYGGSAFEAKSMGV
RGKRYQATDVFVVLVITRSMRNQTAGRLGGVTSREVGVNQLLGAVKTLLINQTLDGLVHP
IQPKRIRTIWNNAEVKKEKLSAYAIEFEISYNECNVLDDGRFPEGVEPNEQVFKQYQGKL
DEPQGDLSGFNNRIFDPNNNAETAFRTEFKDGD
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgattagcaaaattgagcgtgctttgattgagcgtttaacgctgggcttaggcaaaatg
gtgtatgccgttgctgggtatgccggggaaattaacgatgagaagttagatgttctccgt
ttgcctgcttgtcttgtctcttatggtggctcggcgttcgaggcgaaatcaatgggagta
agaggtaaacgctatcaagccactgatgtgtttgtggtgttggttattactcgctcaatg
cgaaatcagactgctgggcgtttaggtggggtaacaagtcgtgaggtgggggttaatcag
ttgctgggagcggtgaaaaccttattgattaaccagactttagacggtttagtccaccct
atccagcctaagcgaatccgcacgatttggaataatgcggaagtgaagaaagagaaactc
tctgcttatgctattgagtttgaaatcagctacaacgagtgcaatgtgcttgatgatggt
agattccccgaaggggttgagccgaatgagcaagtctttaagcagtatcaaggcaagcta
gatgaaccgcaaggcgatttatcgggctttaataatcggatttttgacccgaataacaat
gccgaaacggcatttagaacagaatttaaggatggtgattag

DBGET integrated database retrieval system