KEGG   Mannheimia haemolytica M42548: MHH_c24820Help
Entry
MHH_c24820        CDS       T02635                                 

Definition
(GenBank) Mu-like prophage baseplate J family protein gp47
Organism
mhx  Mannheimia haemolytica M42548
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2344036..2345097
Genome map
AA seq 353 aa AA seqDB search
MYQIPTLEDVRREILRDIQSLEPTADIEVDSDYFVRASALASCVVGLYAHQNWIVRQYFP
DTADSEYLEMHAKLRNLYRKNATYASGSLKVFGTAGSVINEGLQVKFGERFYVTKSSDVI
GDDGSATVRVISMATGASSNVKSESKAQLTAAPAGVSSDCLLLPDVTGGTEVESDAALLA
RLLEQIRRPPSGGNKNDFRQWAESVDGVTSAFVYPLRRGEGTVDIAITSGDTVPSDEIVR
ATQAYIDEVRPVTAKSVYVLKPVEKRVNFNIKVQLDTDTTLDGVKAEIENALENYFLSLK
PADTLIISQIEAVISDLVGVVDREIVQPTRNQTIDAYREMGWFRLGDVTVELM
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaaatcccaacgcttgaagatgttagaagagaaattctgcgagatattcaatct
ttagagccaactgctgatattgaggtggattcggattattttgttcgtgcctccgctttg
gcaagctgtgtggtggggctgtatgctcaccaaaactggattgttcgtcagtatttccca
gatacggcagactccgaatacctcgaaatgcacgctaaattgcgaaatctttaccgtaaa
aatgcgacctatgcgagtggttcgttgaaagtttttggtactgctggctcagtaatcaat
gagggcttgcaagttaaatttggcgagcgtttttatgtaaccaaaagctcggacgttatt
ggtgatgatggctctgcaacggtgcgagtgatttcaatggcaacaggggcatcaagcaat
gttaaatctgaaagtaaagcacaactgactgctgctcctgctggcgtatcaagcgattgc
ttgttattgcctgatgtgacaggcgggacggaagtggaaagcgatgcggcattgctggct
cggttattagagcagattcgccgaccaccgtcaggcgggaataaaaatgacttccgccaa
tgggcagaaagcgttgatggcgtaacctctgcgtttgtttatccattacggcgtggcgag
ggtacggtagatattgcaatcacctcaggtgataccgtgccaagtgatgaaatcgtgcga
gcaactcaagcttatattgatgaagtccgccctgttacggctaaatcggtttatgtactt
aagccagttgaaaaacgggtcaattttaacatcaaagtgcaacttgatacggatacgacg
cttgatggtgtaaaagcggaaatcgaaaacgctttagagaattattttttatcactcaaa
cctgctgacaccttaattatttcgcaaattgaggcagtaattagtgatttagtgggcgta
gtagatcgtgagattgtacagccaaccagaaaccaaacgattgatgcctaccgtgaaatg
ggctggttcagattgggtgatgtaactgtggagttgatgtga

DBGET integrated database retrieval system