KEGG   Mannheimia haemolytica M42548: MHH_c24840Help
Entry
MHH_c24840        CDS       T02635                                 

Definition
(GenBank) Mu-like prophage FluMu defective tail fiber protein
Organism
mhx  Mannheimia haemolytica M42548
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: C1q Minor_capsid_1 End_N_terminal FliMN_C
Motif
Other DBs
NCBI-ProteinID: AGK02922
UniProt: M9X0S8
Position
2345684..2347744
Genome map
AA seq 686 aa AA seqDB search
MKQVMNPINTPTQRFKDGNPATGEYGTIVTAEFLNNVQDSVINTQQELHSVLAEAGIEAN
DEQVNQVAKAIKKIAGDATRDNFNALANPDGYKHIGRCKSVAELRTIRPTEHGQRILVDA
YYEDGTTGGGEFVADLQDLVTPDDGGVCFVVNNNGGRWKRVDLSHLTLFDFWAVGDGVTN
DESAFVNAMRYSQFFIENGTFRINNAVNSVRDNVKILGNKTGKLVLGAGIQQAGAEVFNI
NHSNYFISGFCIETPNKAIGIRFKSLDDAGVKNLHIDNVVFNGTFYGVRAGESIQADTNY
PTDNVIVQNCQSYCGSGNAGHYLCTKVKGVRFFNNIAIGGRNVSAYGATSCSDIFIFGNR
EQGMAVTTVDVEAGVQVEDVQTGECVVANNICSHDIWMSGAKNAIINSNLCRRLRVTSGN
PTDTGSNNVEFSNNQAKSIAISKYGSFDNPSLFIDNINFINNILEPSEFNQDVYIDGTIL
KQCQFINNRCISKSKQYSVRLARNNPFLNLTFKSNKLSDNPAIISGKQGVIFCDDLSLGV
NKHRLRLRFSSPINFTVNQEWQKMPFDRVLNDINGHVDIVSGQFIARTGGTFHLKGKITV
TNSSEDVLNLYQLRLLINNEEKERLINQSVSPKNSKSNTNGMTTINFDTVVDLKVGDIVD
LQYKTTHELTLLSDSFLSQIYVTQEF
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagtgatgaatccgattaataccccaacacagcgttttaaagatggcaaccct
gccactggtgaatatggcacgattgtgactgctgaatttttgaataacgtccaagattcg
gtcattaacacccaacaagaattgcacagtgtacttgctgaagcaggaatcgaagcaaat
gacgaacaagttaatcaggtggctaaagcaatcaagaaaattgcgggcgatgctactcgt
gataattttaacgcattagccaaccctgatggttacaaacacatcggtcgctgcaaatcg
gttgcggagttacgtactatccgcccaacggaacacggtcagcgtattttggtggatgct
tactatgaggacggcacaacaggcggtggggagtttgtggctgatttgcaggatttagtt
acgcctgatgatggtggggtttgttttgttgtgaataataatggggggcggtggaagcgt
gttgacctttcacatcttacattatttgatttttgggccgtcggtgacggggtaacaaat
gatgaatcagcatttgtaaatgctatgagatattctcaattttttatcgaaaacggtaca
tttcgtatcaacaatgccgttaattctgttcgcgataatgtgaaaattttgggcaataag
accggcaaattagtattaggtgcaggtatccagcaagcaggggccgaagtttttaatatt
aatcacagcaattattttatctcgggtttttgtattgaaacaccgaacaaagcaattggt
attcgatttaagtctttggatgatgctggtgttaaaaatctccatattgacaatgttgtg
tttaatggcaccttctacggggtcagggcaggtgaaagtattcaggcggatactaattac
ccaactgataatgtgattgtacaaaactgccaatcgtattgtggttcaggtaatgcggga
cattatctctgcaccaaagttaaaggtgtgcgattttttaacaatatagcaattggaggt
cgcaatgtatcagcttacggtgcaacatcttgctctgatattttcatttttggtaatcgt
gaacaggggatggcagtgacgacagttgatgtggaagcgggcgtacaagtggaagatgta
caaactggcgaatgtgtggtagcgaataatatttgcagccacgatatttggatgtctggt
gctaaaaatgccattatcaacagcaacctctgccgtcgcttgcgtgtcacatcaggtaat
ccgactgacacaggcagcaacaatgtagaattttcaaataatcaagcaaaatctattgca
atatcgaaatatggttctttcgataatccttcattgtttattgataatatcaattttatt
aataacattttggagcccagtgaatttaatcaagatgtgtatattgacgggacaatttta
aaacagtgccaatttattaataatcgttgtattagcaagtctaagcaatattctgtcaga
cttgctcgcaataatccgttcttaaatttaacatttaagagtaataaattatcggacaat
cctgcgattatatcaggtaagcaaggtgttattttctgcgatgatttgagcttaggagta
aataagcacagattaagattgcgattttcatcgccgattaattttactgttaatcaagaa
tggcaaaaaatgccgtttgacagagtgttaaatgatatcaatggtcatgttgatattgtc
agtggtcaatttattgcaaggacaggcgggacttttcatttaaaaggtaaaataacggtt
acaaattcatcggaagatgtgctgaatttatatcaactcaggctgttaataaataacgaa
gagaaagaaagactgattaatcaaagtgtttcacctaaaaacagcaaatcaaatacaaat
ggtatgacaacaatcaattttgatactgtagttgatttaaaagtaggtgacattgttgat
ttgcagtataaaacaacgcatgagttgacattactgtcagactcatttttatctcaaatt
tatgtgactcaggagttttaa

DBGET integrated database retrieval system