KEGG   Mannheimia haemolytica M42548: MHH_c24900Help
Entry
MHH_c24900        CDS       T02635                                 

Definition
(GenBank) DUF4143 domain-containing putative ATPase
  KO
K07133  uncharacterized protein
Organism
mhx  Mannheimia haemolytica M42548
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4143 AAA_14 AAA_16 HTH_23 HTH_28 HTH_36 Rrf2 HTH_11 HTH_29 Sigma70_r4 RPA_C Phage_terminase HTH_Crp_2 HTH_Tnp_ISL3
Motif
Other DBs
NCBI-ProteinID: AGK02927
UniProt: M9X0T5
Position
complement(2351269..2352480)
Genome map
AA seq 403 aa AA seqDB search
MISRQMQSLLKRLVAQFPAVLVTGARQVGKSTLLQHIGEGYQYITFDDPMLLELAKQESR
LFFLNHQGKLILDEVQYVPEIFALLKLEIDKKQQNGLFLLSGSQAFELMQNVSETLAGRI
AILKLQGLSLREILGVKFDQPFLPTTDYLLAREQELKSPENIWQLIHKGDMPRLYAQEVD
WEIYYRSYVATYIERDVRQLTNIASTTDFTRFMVSIASRSGELLNYSNIAQEVGVSNETI
KRWVAILQTSGIIYLLQPYHNNHLKRAIKTPKVYFLDTGLMAYLTKWLTPETIAQGAKSW
QFFETFVVSQIIKSFHNQGIEPPIYFYRDTNQKEIDLIIEYDRTLYPIEIKVTASPTKKM
AKSFDLLNSVSSEWKLGQGAIINQYPTKLYLSENLVALPVSYL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgatttctcggcaaatgcaatcgctgttaaaacgactcgtggcgcaatttcctgccgtt
ttagtgacaggggcaagacaggttggtaaatcgacattgttacaacatattggtgagggc
tatcaatatattacttttgatgacccaatgttgctggagctggctaaacaagaatctcgc
ctgttttttttaaaccatcaaggcaagcttattttagacgaagtacagtatgtgcctgaa
atttttgcgttattaaagttagaaattgataaaaaacagcaaaacggtttgtttttactt
tcggggtcgcaagcctttgaattaatgcagaatgtgagtgaaacacttgccggtcgtatt
gctattttaaaattacaagggctttcgttgcgtgaaattttaggggtgaagttcgatcaa
ccttttttaccgacaaccgactatttgttagctcgggagcaagaattaaaatcaccggag
aacatctggcagcttatccataaaggcgatatgcctcgtttatatgcacaagaggtggat
tgggagatttattatcgctcttatgtagcgacctacattgagcgagatgttcgccaatta
accaatattgccagcacaacggattttacccgttttatggtctctattgcctctcgtagt
ggtgagctactcaattacagtaatattgctcaagaagttggagtatcgaatgaaacgatt
aaacgttgggtcgccattttgcagacttccggcattatctatttgctccagccataccac
aacaatcatttgaaacgggcaattaagaccccaaaagtgtattttctagacaccgggtta
atggcgtatttaaccaaatggcttacccccgaaactattgctcaaggggcaaaaagctgg
cagttctttgaaacctttgtggtaagccaaattataaaatcctttcataatcaaggaatt
gagccgccgatttatttttaccgtgatactaaccagaaagagatcgacttaattattgaa
tatgatcgcacgctttatccgatagaaattaaggtcacggcaagcccaaccaaaaaaatg
gcaaaaagttttgacttgctaaactcagtttctagtgaatggaaattagggcagggagcg
attattaaccaatatccgaccaaactttatttaagtgaaaatttggtagcgttaccggtg
agctatctgtaa

DBGET integrated database retrieval system