KEGG   Mannheimia haemolytica M42548: MHH_c24980Help
Entry
MHH_c24980        CDS       T02635                                 

Definition
(GenBank) YjdF-like inner membrane protein
  KO
K08984  
putative membrane protein
Organism
mhx  Mannheimia haemolytica M42548
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2359288..2359914)
Genome map
AA seq 208 aa AA seqDB search
MDSRSHIIPLFLAIVITVIAVWSGLNPTDRAVWYAEVIPIFIVFALLIITYPKFQFSGLA
YFLMSLWLIMHLIGAKYTFANVPFEWANQFLTPILGEDRNHFDRVAHYIIGFYSFPMAEW
LLRKRKCGMGVAFFFSLFFIMSVAAAYEIIEWQYAVIEGGNAGVEFLGSQGDIWDAQKDM
LADTLGALTALMIYLIARPDLRIHDRHF
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggattcacgctcgcatatcatccctctatttttagcgattgttattaccgtgattgcg
gtttggtcagggttaaatccgacagaccgcgcagtttggtatgcggaagtgataccgatt
tttatcgtttttgcccttttaattatcacttaccctaaatttcagtttagtgggttagct
tattttttgatgtcgctttggctgattatgcacttgatcggggcaaaatatacctttgcc
aatgtgccgtttgagtgggcaaatcaatttctaaccccgattttaggtgaagatcgtaac
cattttgatcgagtagcacattacattatcggtttttacagcttcccgatggcagaatgg
ttactgcgtaaacgcaagtgcggaatgggcgtagcatttttcttctcgctgtttttcatt
atgtcggtggcggcagcttacgaaattattgaatggcaatatgccgtgattgaaggtggc
aatgccggcgtggaatttctaggctcgcaaggggatatttgggacgctcaaaaagatatg
cttgcggatactcttggggcattaaccgcactgatgatttacctgatcgctcgccccgat
ttgcgcattcacgatagacatttttaa

DBGET integrated database retrieval system