KEGG   Mannheimia haemolytica M42548: MHH_c25000Help
Entry
MHH_c25000        CDS       T02635                                 

Definition
(GenBank) putative permease
Organism
mhx  Mannheimia haemolytica M42548
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2360819..2361529)
Genome map
AA seq 236 aa AA seqDB search
MWKNRQLFFGYAENRLLLLSRSITGLLGILCGVYIIDHLVLSDVDMIGKLTSFILIILSA
IFLKERASLLQWILCLIAFIGALFIIKPAVDIRFMPYLVGVIGSVFAAIAYLCLRLLAKT
KKVESPNTIVFFFSAFSTLILLPFVAIDYVVLTNLQTIYLVLAGVTSAVGQFCVTTAYKY
AAAKDISIYSYASVLFSAILGLLFFEQYPDMLSWLGYAIIFVSSWLMFVLTKKQSK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
gtgtggaaaaatcgccaattattctttggttatgcagaaaatcgtttgttattattaagc
cgttccatcaccgggttattggggattttatgtggtgtatatatcatcgatcaccttgtg
ctaagtgatgtcgatatgattggcaaactcacgtcgttcattttaattattctttctgcg
atttttttaaaagagagagcatctctcctgcaatggattttatgccttattgcctttatc
ggggcactttttattatcaaaccggcagttgatattcgctttatgccttatctggttggc
gtgattggctctgtgtttgcagccattgcctatttatgcttaaggttattggcaaaaacc
aaaaaagtagaatcacctaataccattgttttctttttttctgccttttcgaccttgata
ttattgccttttgtcgccattgattatgtagtgctaaccaatttacagacaatctactta
gtgttagcaggggtaacttcagcggtcgggcagttttgtgtaactaccgcctataaatat
gcggcggcgaaagacatctcaatttatagttatgcctctgtgctatttagtgcaatttta
gggttgttgttctttgaacaatacccggatatgttgagttggctaggttatgcaattatt
tttgtctcaagctggcttatgtttgtattaactaaaaagcaatcaaagtaa

DBGET integrated database retrieval system