KEGG   Mannheimia haemolytica M42548: MHH_c25110Help
Entry
MHH_c25110        CDS       T02635                                 

Definition
(GenBank) hypothetical protein
Organism
mhx  Mannheimia haemolytica M42548
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2370173..2370499
Genome map
AA seq 108 aa AA seqDB search
MLKRILGITLCTILVSSNAIASVKTSSLTVAKPTLSKNLPTECEKMFNTANKLVSDAERQ
PGTHTQVLKMKNKLSLTKQQILKMDSELQQKSCEKGLTALNSLKQKHQ
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaagaattttaggaataacactttgtaccatattggtttccagtaatgctata
gcaagtgttaaaacctcatcacttacagttgcaaaacctactttaagtaaaaatttgcca
actgaatgtgagaaaatgtttaacacggcaaataaattggtctctgatgcagaaagacag
cctggtactcatactcaagtgctaaaaatgaaaaataaactttctttaacaaagcaacaa
atcctaaaaatggattctgaattacagcaaaaaagttgtgagaaaggtttaacagcacta
aacagccttaaacaaaaacatcaataa

DBGET integrated database retrieval system