KEGG   Mannheimia haemolytica M42548: MHH_c25130Help
Entry
MHH_c25130        CDS       T02635                                 

Gene name
groS
Definition
(GenBank) 10 kDa chaperonin GroS
  KO
K04078  chaperonin GroES
Organism
mhx  Mannheimia haemolytica M42548
Brite
Chaperones and folding catalysts [BR:mhx03110]
 Heat shock proteins
  HSP10
   MHH_c25130 (groS)
Mitochondrial biogenesis [BR:mhx03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    MHH_c25130 (groS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cpn10 Peptidase_M17 Cupin_6
Motif
Other DBs
NCBI-ProteinID: AGK02950
UniProt: M9X4B4
Position
complement(2372333..2372623)
Genome map
AA seq 96 aa AA seqDB search
MALRPLHDKVILKREEVETKSAGGIVLTGSAATKSTRGKVIAVGTGRILDNGSVQPLAVK
VGDVVIFNEGYGVKTEKIDGEEVLILAEHDILAIVE
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atggcacttcgtccattacacgataaagttattttaaaacgtgaagaagttgaaacaaaa
tcggcaggcggtattgttttaaccggttcggcagcaacaaaatcaacccgtggcaaagta
attgcagtaggaacaggtcgcattttagacaatggttctgttcagcctttagcagttaaa
gtgggcgatgtagtgatttttaacgaaggctacggcgtaaaaaccgagaaaattgacggc
gaagaagtgctaattttagcagagcacgatattttggcgattgtagaataa

DBGET integrated database retrieval system