KEGG   Mannheimia haemolytica M42548: MHH_c25230Help
Entry
MHH_c25230        CDS       T02635                                 

Gene name
bolA
Definition
(GenBank) DNA-binding transcriptional dual regulator BolA
  KO
K05527  BolA family transcriptional regulator, general stress-responsive regulator
Organism
mhx  Mannheimia haemolytica M42548
Brite
Transcription factors [BR:mhx03000]
 Prokaryotic Type
  Other transcription factors
   Others
    MHH_c25230 (bolA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BolA Tautomerase_2 Dopey_N NTP_transf_6
Motif
Other DBs
NCBI-ProteinID: AGK02959
UniProt: M9X7N2
Position
complement(2379444..2379755)
Genome map
AA seq 103 aa AA seqDB search
MSVEQTIIQKIKTEFQPIFFNVENESYMHSSGRGAESHFKLTLVSDKFEGQRTVARHRAV
YACLAEELANGVHALALHLYTQGEWEATGGLVPKSLNCLGVGQ
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtagaacagacaattattcaaaaaattaagacagaatttcagccgattttcttt
aatgtcgaaaacgaaagctatatgcacagctcaggtagaggagcagaatcgcattttaaa
ttaactttggtgtcagataaatttgaagggcagagaacagttgcacgtcatcgtgctgtc
tatgcttgcttagctgaggaattagctaatggcgttcacgcacttgctttgcacctatat
acccaaggtgaatgggaagcgactggcggacttgtacctaaatcgctaaattgcttaggt
gttgggcaataa

DBGET integrated database retrieval system