KEGG   Mannheimia haemolytica M42548: MHH_c25430Help
Entry
MHH_c25430        CDS       T02635                                 

Definition
(GenBank) hypothetical protein
Organism
mhx  Mannheimia haemolytica M42548
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AGK02979
UniProt: M9X7Q8
Position
complement(2392291..2392539)
Genome map
AA seq 82 aa AA seqDB search
MISGEKMTWESLGASAIGGAIGGGIGATMKAGAVTASTLSALGGGMGEGLYKSTSQGIKN
SIGIKASCNQSGSDYGDGCDYQ
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atgatttctggggaaaaaatgacttgggagagtttgggagcatcagctataggtggggct
attggtggcggtattggagcaacaatgaaagctggtgcggtgacagcgtcaaccttatct
gctttaggtggtggtatgggggagggcttgtataaaagtacttctcaaggtatcaaaaat
agtattggtataaaggcgagttgcaatcaatcaggttcggattatggtgatggatgtgat
tatcaataa

DBGET integrated database retrieval system