KEGG   Mannheimia haemolytica M42548: MHH_c25470Help
Entry
MHH_c25470        CDS       T02635                                 

Gene name
thiI
Definition
(GenBank) tRNA sulfurtransferase ThiI
  KO
K03151  
tRNA uracil 4-sulfurtransferase [EC:2.8.1.4]
Organism
mhx  Mannheimia haemolytica M42548
Pathway
Thiamine metabolism
Metabolic pathways
Sulfur relay system
Brite
KEGG Orthology (KO) [BR:mhx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    MHH_c25470 (thiI)
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    MHH_c25470 (thiI)
Enzymes [BR:mhx01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.4  tRNA uracil 4-sulfurtransferase
     MHH_c25470 (thiI)
Transfer RNA biogenesis [BR:mhx03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    MHH_c25470 (thiI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2397641..2399092)
Genome map
AA seq 483 aa AA seqDB search
MKFIIKLFPEIMIKSDSVRKRFIKILTSNIRNVLLKETENVSVVRHWDFIEVRAKVDEET
ALVLDLLKRTPGIHHILEVEETPFTDMHDIFEQTYAAVKAELEGKTFSVRVRRKGKHDFR
SLDVERYVGGGLNQRIETAKVKLTNPDVTVRIDIEHDKMLLIKARHEGLGGYPIGTQEDV
LSLISGGFDSGVSSYMLIRRGSRVHYCFFNLGGAAHEIGVKQMAYHIWSRYSTSHKVRFI
AINFENVVGEILEKVDNGQMGVVLKRMMVRAASRIAERFDIQAIVTGEALGQVSSQTLTN
LRLIDKASDTLVLRPLITHDKEQIIAMAKAIGTDDIAKSMPEFCGVISKNPTVKAIETKI
LEEEGNFNFEVLEQAVQTASYLDIREIAQQTEKEVVSVETTTELSKNDVVLDIRSPEEVD
EKPFRLDGVEVKELPFYKLSSQFSTLDQSKTYLLYCQRGVMSKLQALYLKENGYSNVKVF
RVK
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttatcatcaaacttttccctgaaattatgattaaaagcgactctgttcggaaa
cgctttatcaaaattttaacctcaaatattcgcaacgtattattaaaagagactgaaaat
gtgtctgtggttcgccattgggactttattgaagttcgggcgaaagtggacgaagaaacg
gcattagtgctggatttgcttaaacgcacgccgggtattcaccatattttagaagtggag
gaaaccccttttacggatatgcacgatatttttgagcagacttatgccgcagtgaaagct
gaactagaaggcaaaacgtttagcgtgcgggttcgccgtaaaggaaagcacgatttccgt
tctcttgatgtagagcgttatgtcggtggtgggctgaatcagcggattgaaacggcgaaa
gtgaaattaaccaacccagatgttacggtcagaattgatattgaacatgataaaatgttg
ctgattaaagctcgccacgaagggttaggcgggtatccaatcggcacacaagaagatgtg
ttgtcattgatttcgggtggttttgattcgggtgtatcgagctatatgctgattcgcaga
ggttctcgtgtgcattactgttttttcaatttaggtggtgccgcacacgaaattggcgtg
aaacagatggcatatcatatttggagccgttatagtacctcgcacaaagtccgttttatc
gccattaattttgaaaatgtagtgggtgagattttagaaaaagttgataacggacaaatg
ggcgtggtattaaaacgtatgatggtgcgagcggcaagccgtattgccgagcgttttgat
attcaagcgattgtgaccggtgaggcgttggggcaggtctctagccaaacactgactaat
ttacgtttaattgataaggcatcagatacgctggtattacgtccgctcatcactcacgat
aaagagcagattattgcaatggcaaaagcgataggcactgacgatattgctaaatcaatg
ccggagttctgtggagtaatttctaaaaatccgacggttaaggcaatcgaaactaaaatt
ttggaagaagaaggcaactttaattttgaggtactagaacaagcggttcaaacggcgagt
tatttagatattcgtgagatcgctcagcaaaccgaaaaagaggttgtttcggttgaaacc
acaacagaattgagtaaaaacgatgttgtgctagatattcgcagcccggaagaggttgat
gaaaaaccattccgtttagacggggttgaagtaaaagaactcccgttttataaactttcc
agccagtttagtacgcttgaccaaagcaaaacctacttgctctattgccaacgtggggta
atgagtaaactgcaggctctttatttgaaagagaatggctacagcaatgtaaaagtgttt
cgagtgaaataa

DBGET integrated database retrieval system