KEGG   Mannheimia haemolytica M42548: MHH_c25640Help
Entry
MHH_c25640        CDS       T02635                                 

Definition
(GenBank) truncated ISVvu4 transposase
Organism
mhx  Mannheimia haemolytica M42548
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_29 HTH_28 HTH_32 HTH_23 rve HTH_8 HTH_21 HTH_7
Motif
Other DBs
NCBI-ProteinID: AGK02998
UniProt: M9X8X5
Position
complement(2408456..2409148)
Genome map
AA seq 230 aa AA seqDB search
MFYSNNPLIKHKTGLLNLAEELGNISQACKVMGMSRDTFYRYQQAVEQGGVEALLNQNRR
VPNLKNRVDEAIEQAVVKFALDNPAFGQVRVSKELRKQGIFVSAGGVRSIWLRHHLANFK
QRLIALEKLVAEQGIILSETQVQALERKKEDEIACGEIETVHPGYLGSQDTFYVGNLKGV
GRIYQQTFIDTYSKVAFAKLYTMKTAISAADITFFAHTAIIQWWIAEKLL
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgttttattctaacaaccctctcattaaacacaagaccggtttattaaatttagcagaa
gaactgggtaatatttctcaagcctgcaaagtaatgggaatgagccgagatacattctat
cgttatcaacaagcggttgagcaaggtggtgttgaagcattgctgaatcaaaatagacgc
gttcccaacttaaaaaatcgtgttgatgaggcaatagagcaagctgttgtgaagtttgct
cttgataacccggcatttggacaggtaagagtgagtaaggaactccgtaaacaaggcatc
tttgtttcagcaggaggtgtacgttcgatttggttacgtcatcatcttgccaattttaag
caaagattaatcgccctggaaaaactggttgcagaacaaggtattatactcagtgaaaca
caggtacaagccttagagcgtaagaaagaagatgagattgcctgtggtgaaattgaaacg
gtacaccctggctatcttggctcacaagatactttctatgtgggcaacctcaaaggagtg
ggtcgtatttatcaacaaacgtttattgatacttacagtaaagtggcgtttgcaaaactt
tatacaatgaagaccgctatcagtgctgcggatattactttctttgctcacaccgctatt
attcagtggtggatagccgagaaactgctgtaa

DBGET integrated database retrieval system