KEGG   Mannheimia haemolytica M42548: MHH_c25650Help
Entry
MHH_c25650        CDS       T02635                                 

Gene name
intD
Definition
(GenBank) prophage DLP12 integrase IntD
Organism
mhx  Mannheimia haemolytica M42548
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_integrase Phage_int_SAM_5 DUF1018 DUF2914 BssS
Motif
Other DBs
NCBI-ProteinID: AGK02999
UniProt: M9X7U1
Position
complement(2409246..2409959)
Genome map
AA seq 237 aa AA seqDB search
MSIYRRKANGPWWVDITTPNGKRIKRSTRTLVKREAQQYHDKLKQEMWAEDKLEEKRKYI
FEDALLHYVRAAEELKDKATKKRHAEYWLSKFAGRELSSLTAQEIILNIPKKNANTKKPL
SHSTQNKYVKSLSRVLNIAHKLGMLDAVPHIPKKKEPPIRVRWITKEQAKQLIDKLSSDW
MKSICKFALMTGARRTEILTMTWDKIDLVRKVAIVTNDVAKSGKARSLLLNQEAIKL
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatctacagacgaaaagcaaacggtccgtggtgggttgatatcacaaccccaaac
ggcaagagaattaagagaagcactcgcacgcttgtaaaacgtgaagctcagcagtatcac
gataaactcaagcaagaaatgtgggcagaggataaactcgaggaaaagagaaaatatatc
tttgaagatgctttgctccattacgttcgtgcggccgaagaattaaaagataaagccaca
aaaaagcgacatgctgaatactggttatccaaatttgccggtcgtgaactcagctcttta
acagctcaggagattatcctaaatatcccgaaaaagaatgcaaatacgaaaaagcctcta
tctcatagtacgcaaaataagtatgtgaaatctttatcgagagtattaaatatcgctcat
aaacttggtatgttggatgcagtcccacacataccgaaaaagaaagagccgccaattcgt
gtacgctggatcaccaaagaacaagcaaaacagctaatagataaattaagttcagactgg
atgaaatctatctgtaagtttgctttgatgactggagccagacggacagaaattttgaca
atgacttgggataagatagatcttgtaagaaaggtagcaatcgtgactaatgatgtcgct
aaatcaggtaaggcacgatcgctattactgaatcaagaggcaattaagctgtag

DBGET integrated database retrieval system