KEGG   Mannheimia haemolytica M42548: MHH_c25810Help
Entry
MHH_c25810        CDS       T02635                                 

Definition
(GenBank) hypothetical protein
Organism
mhx  Mannheimia haemolytica M42548
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2418082..2418210
Genome map
AA seq 42 aa AA seqDB search
MVSACTTQYKQDYTTKPTFCYQLAPQEQLPGKNCIGSGGHSG
NT seq 129 nt NT seq  +upstreamnt  +downstreamnt
atggtttcagcttgtacaactcaatataagcaagactatacaacaaaaccaaccttttgt
tatcaactagcccctcaagagcaattaccggggaaaaactgtattggctcaggagggcat
tcaggttaa

DBGET integrated database retrieval system