KEGG   Mannheimia haemolytica M42548: MHH_c25910Help
Entry
MHH_c25910        CDS       T02635                                 

Gene name
ompW
Definition
(GenBank) outer membrane protein OmpW
  KO
K07275  outer membrane protein
Organism
mhx  Mannheimia haemolytica M42548
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OmpW OMP_b-brl Opacity OprF CBP_BcsS
Motif
Other DBs
NCBI-ProteinID: AGK03024
UniProt: M9X7V7
Position
complement(2424035..2424706)
Genome map
AA seq 223 aa AA seqDB search
MKKSTLAIILGGALLTGTAVAHQAGDVIFRAGAVHVKANSSSDAKSKAATGIDVDLEVKN
NTQLGLTATYMLADNVGIELLGATPFSHKINAKAKVLESGAEVDLDRVVILKQLPPSLYA
QYYFFELTAKVKPYVGAGLNYTRFYHAKSVSPAVTDLSVKKHSFGPVANLGVDVKLTDNI
YFNAAAWYTRIKTTAKFKAAGADHEVKVKLDPVVLFAGFGVKF
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatcaactttagcaattattttaggtggggcattattaactggaactgcggtg
gcacatcaagcaggtgatgtgatattccgtgccggtgcggtacatgttaaggcaaattca
agttcagatgcaaaatcaaaagcagcgacaggtattgatgtagatttagaagtgaaaaac
aatactcagttaggcttaactgcaacttatatgttagccgataatgtgggtattgagtta
ttaggtgcaacccctttctctcataaaattaatgccaaagccaaagttttagaatcaggt
gcagaagtagatttggatagagttgttatcttaaaacaattaccaccgagcctttatgcc
caatactatttctttgagctaactgcaaaagtaaaaccttacgttggtgcaggtttaaat
tacactcgcttctaccacgctaaatcagttagccctgctgttactgacttaagtgtaaaa
aaacattctttcggaccggtagcaaacctaggtgttgatgtaaaattaaccgataacatc
tacttcaacgcggcagcttggtacacacgcattaaaacaaccgcaaaatttaaagcagca
ggtgcagatcacgaagtaaaagtaaaacttgatccggttgtcttatttgccggtttcggg
gtgaagttctaa

DBGET integrated database retrieval system