KEGG   Mannheimia haemolytica M42548: MHH_c25930Help
Entry
MHH_c25930        CDS       T02635                                 

Definition
(GenBank) putative MetE-like homocysteine transmethylase
  KO
K00549  
5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase [EC:2.1.1.14]
Organism
mhx  Mannheimia haemolytica M42548
Pathway
Cysteine and methionine metabolism
Selenocompound metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mhx00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    MHH_c25930
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    MHH_c25930
Enzymes [BR:mhx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.14  5-methyltetrahydropteroyltriglutamate---homocysteine S-methyltransferase
     MHH_c25930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2427742..2428884
Genome map
AA seq 380 aa AA seqDB search
MSQLFPEATIRTQAPYRNDIVGSFLRTDALKKAREDFNQQKITRDELREVTRQEVKKLVE
LQKQHGVKAVSDGEFSRTWWHLDFLAELDGMDWQETEVFNVNFTGHKPKGQTVKIVGDID
FSESHPFVDAYRLLKEAAGDYPTKFTIPAPTMLHIICCVRAEDYQPLPQYQDEQKLYDDI
ANAYIKAMHKFYDMGLRNLQLDDTSWGQFCAEDKRKEFAARGFNLTDLAEKYVALLNRIV
DAKPADMSITMHICRGNFRSSWFSEGGYGPVAEVLFGKCRVDGFFLEYDTERAGTFEPLR
HIKDQQVVLGLITSKFGDLEDKNVIIERIKEAAQIVPINQLCLSPQCGFASTEEGNILTE
AAQWAKLNLIKEIAEEVWGS
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgagccaattatttccggaagcaacaatccgcactcaagccccgtatcgtaatgatatt
gtaggcagctttctacgtaccgatgcgttaaaaaaagccagagaagatttcaatcagcaa
aaaatcacccgtgacgaattgcgtgaagtcacacgccaagaggtcaaaaaattagttgag
ttgcaaaagcaacacggtgtaaaagcagtctctgacggtgaatttagccggacttggtgg
catttagatttcttagctgaacttgatggaatggattggcaagaaaccgaagtctttaac
gtgaactttaccggtcataaacccaaagggcaaacggtaaaaatcgtgggcgatattgat
ttctccgaaagccacccttttgtggacgcttatcgtcttttaaaagaagctgccggcgat
tacccaaccaaattcacgattccggcaccgacaatgttacatattatctgctgtgtgcgt
gcggaagattaccaaccgttaccacaatatcaagacgaacaaaaactgtacgatgatatt
gctaatgcttatatcaaagcaatgcacaaattctacgatatggggctacgtaacttacaa
ttagacgacaccagttggggacaattctgtgccgaagataaacggaaagagtttgcagcc
agaggatttaatttaactgatttagcggaaaaatatgtcgcattattaaaccgtattgtt
gatgcaaaaccggcggatatgtcaattacgatgcacatctgccgtggtaacttccgttct
tcttggttctcggaaggcggttatggaccggttgccgaagtattattcggtaaatgccgt
gttgacggcttcttcttagaatacgataccgaacgtgcaggcactttcgagccactacgc
cacattaaagatcaacaagtggtactaggcttaattacctctaaatttggcgatttagaa
gataaaaatgtgatcattgagcgtattaaagaagcggctcaaattgtgccaatcaatcag
ctatgcttatcaccacaatgcggctttgcctccaccgaagaaggcaatattttaaccgaa
gccgcacaatgggcgaaactaaacttaattaaagaaattgcggaagaagtttggggtagc
taa

DBGET integrated database retrieval system