KEGG   Mycoplasma hyopneumoniae 232: mhp121Help
Entry
mhp121            CDS       T00206                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mhy  Mycoplasma hyopneumoniae 232
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mhy03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(142301..142885)
Genome map
AA seq 194 aa AA seqDB search
MIKETFKNLAEDLRKIPGISKKQAMRILSFLVDVPIEKIENFVRAICDLKKNTQYCEKCG
YLNTNPVCEICLDFQRSFKILVVENTEMIAKFEEYGKYDGQYFVFGKYDIKNLENHNTQI
KKLADLAANKSEIILGLSSTMEGLIFANYLAKHEFLSGLKITRLATGIPFGAIIDYIDNI
TLDQALKNRQEMEK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaagaaacatttaaaaatcttgctgaggatttaagaaaaatcccgggaatttcc
aaaaaacaagcaatgcgaattttgtcttttttggttgatgttccaattgaaaaaattgaa
aattttgttagagcaatttgtgatttaaaaaaaaacacacaatattgtgaaaaatgtggg
tatttaaatactaatccagtttgtgaaatatgccttgatttccaacggtcttttaaaatt
ttagtagttgaaaataccgaaatgattgctaaatttgaagaatatggaaaatatgatggt
caatattttgtctttggtaaatatgatattaaaaatttagaaaatcataatacccaaatt
aaaaaattagctgatttagccgctaataaaagtgagataattcttggtttatcttcgaca
atggagggactgatttttgcaaattatctcgcaaaacacgagtttttatccggccttaaa
attactcggcttgcaactggaattccatttggagcaataattgattatatcgataatatc
accttagatcaagcgcttaaaaatcgacaagaaatggaaaaataa

DBGET integrated database retrieval system