KEGG   Mycoplasma hyopneumoniae 232: mhp229Help
Entry
mhp229            CDS       T00206                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mhy  Mycoplasma hyopneumoniae 232
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mhy00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
255926..256519
Genome map
AA seq 197 aa AA seqDB search
MKVKMSKLIILSGPSGVGKGTIESLLLKNKNLLIKLAISATTREKRRDEINGVNYFFLTV
QEFKEKIENDEFIEWSCHFNNYYGTLKSQIKFIQSQNFIPLLEIDTTGAKNIIENYKNKG
ELSQLLTIFILPPSIESLKNRIQKRLTETNIQINQRLEKAKAEIKIKNLFKFQVVNDNLE
ECVAQIEKIISKEIQKT
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtaaaaatgagtaaattaataattttgtctggaccttcaggggttggcaagggc
acaattgaatcacttttattaaaaaataaaaatttattaataaagttagcaatttctgca
acaactcgagaaaaaaggagagacgaaattaacggagttaattattttttcctaacagtt
caagagtttaaagaaaaaattgaaaatgatgaatttattgaatgaagttgtcattttaat
aattattatgggaccctaaaatcgcagattaagtttattcagtctcaaaattttatccca
ttattggaaattgatacaacaggtgctaaaaatattattgaaaattacaaaaataaaggt
gaattatcccaacttttaactatttttatcctccctccttccattgaatctcttaaaaac
cggattcaaaaacgtctaacagaaacaaatattcaaataaatcaacgactagaaaaagcc
aaagctgagattaaaattaaaaatttgttcaaatttcaagtggttaatgacaatttagaa
gaatgtgttgcccaaatagaaaaaattataagtaaagagatccaaaaaacttag

DBGET integrated database retrieval system