KEGG   Mycoplasma hyopneumoniae 232: mhp277Help
Entry
mhp277            CDS       T00206                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mhy  Mycoplasma hyopneumoniae 232
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mhy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    mhp277 (tpiA)
   01230 Biosynthesis of amino acids
    mhp277 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mhp277 (tpiA)
   00051 Fructose and mannose metabolism
    mhp277 (tpiA)
   00562 Inositol phosphate metabolism
    mhp277 (tpiA)
Enzymes [BR:mhy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     mhp277 (tpiA)
Exosome [BR:mhy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   mhp277 (tpiA)
  Exosomal proteins of bladder cancer cells
   mhp277 (tpiA)
  Exosomal proteins of melanoma cells
   mhp277 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(309630..310358)
Genome map
AA seq 242 aa AA seqDB search
MKKIIIGNWKMNKTVSETRDFIQKFDIFYQENVGKIKEDLDFAIAPSFISLSLISKSLTK
KLEIAAQNLSQFDSGAFTGEISGKMLQDLGTKYVIIGHSERREIFKEKDEELKNKILQAQ
KYDLIPVFCVGESLLEFEAGLTKKVIISQINAIKSVLNFQKAIIAYEPIWAIGTGKTATA
AIAEKVCGLIKENFGKNTMVIYGGSVNSKNINELVSQKSIDGALVGGASLDPEEFGKILV
NS
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattattattggaaattgaaaaatgaataaaaccgtaagtgaaacacgtgat
tttattcaaaaatttgacattttctatcaggaaaatgtgggcaaaatcaaagaagattta
gattttgcaatagctccaagttttatatctttatcactaatttctaagtccttgactaaa
aaattagaaattgctgctcaaaatcttagtcagtttgattcaggagcctttactggggaa
atcagtggcaaaatgctgcaggatttagggacaaaatatgtaattattgggcattctgaa
agaagagaaatttttaaagaaaaagatgaagaactaaaaaataaaattttacaagcacaa
aaatatgatttaattcctgttttttgtgttggtgaaagtcttttagaatttgaagccggc
ctaactaaaaaagtgataatttcgcagataaatgctataaaatcagtgctaaattttcaa
aaggcaattattgcatatgaaccaatttgggccattggaactggcaaaacagcaacggct
gcaatagcagaaaaagtttgtggactgattaaggaaaattttgggaaaaatacaatggta
atttatggaggctctgttaattctaagaatattaacgagttagtatcccagaaaagcatc
gatggcgcccttgtaggtggagcctctcttgatccagaagaatttggaaaaattttagtt
aatagttaa

DBGET integrated database retrieval system