KEGG   Mycoplasma hyopneumoniae 232: mhp277Help
Entry
mhp277            CDS       T00206                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mhy  Mycoplasma hyopneumoniae 232
Pathway
mhy00010  Glycolysis / Gluconeogenesis
mhy00051  Fructose and mannose metabolism
mhy00562  Inositol phosphate metabolism
mhy01100  Metabolic pathways
mhy01110  Biosynthesis of secondary metabolites
mhy01120  Microbial metabolism in diverse environments
mhy01130  Biosynthesis of antibiotics
mhy01200  Carbon metabolism
mhy01230  Biosynthesis of amino acids
Module
mhy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mhy_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mhy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mhp277 (tpiA)
   00051 Fructose and mannose metabolism
    mhp277 (tpiA)
   00562 Inositol phosphate metabolism
    mhp277 (tpiA)
Enzymes [BR:mhy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     mhp277 (tpiA)
Exosome [BR:mhy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   mhp277 (tpiA)
  Exosomal proteins of bladder cancer cells
   mhp277 (tpiA)
  Exosomal proteins of melanoma cells
   mhp277 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AAV27802
UniProt: P0C0J6
Position
complement(309630..310358)
Genome map
AA seq 242 aa AA seqDB search
MKKIIIGNWKMNKTVSETRDFIQKFDIFYQENVGKIKEDLDFAIAPSFISLSLISKSLTK
KLEIAAQNLSQFDSGAFTGEISGKMLQDLGTKYVIIGHSERREIFKEKDEELKNKILQAQ
KYDLIPVFCVGESLLEFEAGLTKKVIISQINAIKSVLNFQKAIIAYEPIWAIGTGKTATA
AIAEKVCGLIKENFGKNTMVIYGGSVNSKNINELVSQKSIDGALVGGASLDPEEFGKILV
NS
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattattattggaaattgaaaaatgaataaaaccgtaagtgaaacacgtgat
tttattcaaaaatttgacattttctatcaggaaaatgtgggcaaaatcaaagaagattta
gattttgcaatagctccaagttttatatctttatcactaatttctaagtccttgactaaa
aaattagaaattgctgctcaaaatcttagtcagtttgattcaggagcctttactggggaa
atcagtggcaaaatgctgcaggatttagggacaaaatatgtaattattgggcattctgaa
agaagagaaatttttaaagaaaaagatgaagaactaaaaaataaaattttacaagcacaa
aaatatgatttaattcctgttttttgtgttggtgaaagtcttttagaatttgaagccggc
ctaactaaaaaagtgataatttcgcagataaatgctataaaatcagtgctaaattttcaa
aaggcaattattgcatatgaaccaatttgggccattggaactggcaaaacagcaacggct
gcaatagcagaaaaagtttgtggactgattaaggaaaattttgggaaaaatacaatggta
atttatggaggctctgttaattctaagaatattaacgagttagtatcccagaaaagcatc
gatggcgcccttgtaggtggagcctctcttgatccagaagaatttggaaaaattttagtt
aatagttaa

DBGET integrated database retrieval system