KEGG   Mycoplasma hyopneumoniae 232: mhp421Help
Entry
mhp421            CDS       T00206                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mhy  Mycoplasma hyopneumoniae 232
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mhy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    mhp421 (ruvA)
Enzymes [BR:mhy01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     mhp421 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
499287..499952
Genome map
AA seq 221 aa AA seqDB search
MQIYQFGKIVSKNKNYLILENHGSGYLIYVPRIDRFSRDENRKIYIYEHENDYTKITYGF
ASFRERILFEDLISIQGVGPKTAISALNSGMQNLINLIAANDWKTLAKIPYLSEKNAKQI
VFEFQKKYERFNENHKNQTEETNPETQEKELEKEDDLADITIQKSNLEDKTAANLEDTLK
MLGFKPRQIDYALTKVEPNENFENLIENAIKIISNAREFRN
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatctatcaattcggaaaaattgtctcaaaaaacaaaaactatttaattcttgaa
aaccacggcagtggctatcttatttatgtacctcgaatcgatcgttttagccgcgacgaa
aatcgcaaaatttatatttatgaacatgaaaatgactatacaaaaataacttacggtttt
gcgagcttccgtgagcggattttgtttgaagatctaatttcaattcaaggggttggacct
aaaaccgcaatttctgcacttaattcgggaatgcagaatttaattaatttaattgccgcg
aacgactgaaaaacgctggcaaaaattccttatctttctgagaaaaatgcaaaacaaata
gtctttgaatttcaaaaaaaatacgaaagatttaacgaaaaccataaaaaccaaacagag
gaaacaaatccagagactcaagaaaaagaactagaaaaagaggatgatttagctgatatt
accatccaaaaatcaaatcttgaagacaaaacagccgcaaatcttgaggatactttgaaa
atgcttggtttcaaaccacggcaaattgattatgcgcttacaaaagttgaacctaatgaa
aattttgaaaatttaattgaaaacgcaattaaaattatatcaaatgccagagaatttaga
aattag

DBGET integrated database retrieval system