KEGG   Mycoplasma hyopneumoniae 232: mhp421Help
Entry
mhp421            CDS       T00206                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mhy  Mycoplasma hyopneumoniae 232
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mhy03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
499287..499952
Genome map
AA seq 221 aa AA seqDB search
MQIYQFGKIVSKNKNYLILENHGSGYLIYVPRIDRFSRDENRKIYIYEHENDYTKITYGF
ASFRERILFEDLISIQGVGPKTAISALNSGMQNLINLIAANDWKTLAKIPYLSEKNAKQI
VFEFQKKYERFNENHKNQTEETNPETQEKELEKEDDLADITIQKSNLEDKTAANLEDTLK
MLGFKPRQIDYALTKVEPNENFENLIENAIKIISNAREFRN
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatctatcaattcggaaaaattgtctcaaaaaacaaaaactatttaattcttgaa
aaccacggcagtggctatcttatttatgtacctcgaatcgatcgttttagccgcgacgaa
aatcgcaaaatttatatttatgaacatgaaaatgactatacaaaaataacttacggtttt
gcgagcttccgtgagcggattttgtttgaagatctaatttcaattcaaggggttggacct
aaaaccgcaatttctgcacttaattcgggaatgcagaatttaattaatttaattgccgcg
aacgactgaaaaacgctggcaaaaattccttatctttctgagaaaaatgcaaaacaaata
gtctttgaatttcaaaaaaaatacgaaagatttaacgaaaaccataaaaaccaaacagag
gaaacaaatccagagactcaagaaaaagaactagaaaaagaggatgatttagctgatatt
accatccaaaaatcaaatcttgaagacaaaacagccgcaaatcttgaggatactttgaaa
atgcttggtttcaaaccacggcaaattgattatgcgcttacaaaagttgaacctaatgaa
aattttgaaaatttaattgaaaacgcaattaaaattatatcaaatgccagagaatttaga
aattag

DBGET integrated database retrieval system