KEGG   Mycoplasma hyopneumoniae 232: mhp595Help
Entry
mhp595            CDS       T00206                                 

Gene name
fpg
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mhy  Mycoplasma hyopneumoniae 232
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mhy03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
744750..745577
Genome map
AA seq 275 aa AA seqDB search
MPELPEVITVVNALKTEVIGKKIKNVLARDSNFIKEINFFDFQKSIVNATIIDIQNRAKH
ILIFLDNRKVILSHLRMNGKYFTYKSPQWGKYDYISFVFSDNSVLNYNDSRKFGTFMIRD
VELLFKTKPLKDLAPEPFFIKVDDFYQKIRKSTRSIKAILLDQKIISGLGNIYADEVCFA
TKIFPGKAAKLISRKEAELIIDFSKKILQESIKLGGSSISSYTSLNAKEGKFQNFLKVHT
KQNFPCSNCQTKILKTVIAGRGTYFCPFCQKLDNF
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgccagaattaccagaagttatcacggttgtaaacgcgttaaaaaccgaggtaattggt
aaaaaaattaaaaatgttttggcccgtgatagtaattttatcaaggaaattaattttttt
gattttcaaaaatccattgtaaatgcgactattattgacatccaaaatcgggctaaacat
atattaatttttcttgacaaccgaaaagttatcttatcacatctaagaatgaatgggaaa
tattttacatataaatcgcctcaatgaggaaagtatgactatatttcctttgttttttct
gataatagcgtcctaaattacaacgatagtcgtaagtttggaacttttatgattcgggat
gtggaattattatttaaaactaaaccacttaaagatttggcgcctgaacctttttttatt
aaggttgatgatttttatcagaaaatcagaaaatcaacacgctcgattaaggcaattttg
cttgatcaaaaaattattagtgggctagggaatatttatgctgatgaagtttgttttgca
acaaaaattttcccgggaaaagctgcaaaattgatttctcgaaaagaggcagaattaata
attgactttagcaaaaaaattctacaagaatcaattaaacttggcggttcaagcatcagt
tcttatacatctttgaatgcaaaagagggaaaatttcaaaattttttaaaggttcataca
aaacaaaattttccttgctcaaattgccaaactaaaattttaaaaacagttattgctggt
aggggaacatatttttgccctttttgtcaaaaattagacaatttttaa

DBGET integrated database retrieval system