KEGG   Mycoplasma hyopneumoniae 168-L: MHP168L_587Help
Entry
MHP168L_587       CDS       T02675                                 

Definition
DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mhyl  Mycoplasma hyopneumoniae 168-L
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mhyl03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
753679..754506
Genome map
AA seq 275 aa AA seqDB search
MPELPEVITVVNALKTEVIGKKIKNVLARDSNFIKEINFFDFQKSIVNATIIDIQNRAKH
ILIFLDNRKVILSHLRMNGKYFTYKSPQWGKYDYISFVFSDNSVLNYNDSRKFGTFMIRD
VELLFKTKPLKDLAPEPFFIKVDDFYQKIRKSSRSIKAILLDQKIISGLGNIYADEVCFA
TKIFPGKAAKLISRKEAELIIDFSKKILQESIKLGGSSISSYTSLNAKEGKFQNFLKVHT
KQNFPCSNCQTKILKTVIAGRGTYFCPFCQKLDNF
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgccagaattaccagaagttatcacggttgtaaacgcgttaaaaaccgaggtaattggt
aaaaaaattaaaaatgttttggcccgtgatagtaattttatcaaggaaattaattttttt
gattttcaaaaatccattgtaaatgcgactattattgacatccaaaatcgggctaaacat
atattaatttttcttgacaaccgaaaagttatcttatcacatctaagaatgaatgggaaa
tattttacatataaatcgcctcaatgaggaaagtatgactatatttcctttgttttttct
gataatagcgtcctaaattacaacgatagtcgtaagtttggaacttttatgattcgggat
gtggaattattatttaaaactaaaccacttaaagatttggcgcctgaacctttttttatt
aaggttgatgatttttatcagaaaatcagaaaatcatcacgctcgattaaggcaattttg
cttgatcaaaaaattattagtgggctagggaatatttatgctgatgaagtttgttttgca
acaaaaattttcccgggaaaagctgcaaaattgatttctcgaaaagaggcagaattaata
attgactttagcaaaaaaattctacaagaatcaattaaacttggcggttcaagcatcagt
tcttatacatctttgaatgcaaaagagggaaaatttcaaaattttttaaaggttcataca
aaacaaaattttccttgctcaaattgccaaactaaaattttaaaaacagttattgctggt
aggggaacatatttttgccctttttgtcaaaaattagacaatttttaa

DBGET integrated database retrieval system