KEGG   Mycoplasma hyopneumoniae 7422: MHL_2289Help
Entry
MHL_2289          CDS       T02750                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
mhyo  Mycoplasma hyopneumoniae 7422
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mhyo00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
790602..791156
Genome map
AA seq 184 aa AA seqDB search
MYKKFFDGVIEVITGPMFSGKSDELIKRIKILTYADIKTLVIKPSVDYRFSQCEIVSRSG
LKIPTFLARTTQEIRDLFTRDNYQAIAIDEIQFFDEEIVTFLEQIADKGIRVIVSGLDQD
FRRKPFGSLPNLMAIAENVTKLQAVCSLCKRAATTTARKVLNEAQTLIGDQDEYEARCRA
CHSL
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaaaaattttttgatggggtcattgaagtaattacagggccaatgttttcaggg
aaatctgatgagttaattaaaaggataaaaattctaacttatgccgatattaaaacttta
gtgataaaaccttcagttgattaccgtttttcccagtgcgaaatcgtctcgcggtcaggt
ttgaaaattcccacttttttggccagaacaacacaagaaatccgggatttatttacaaga
gataactaccaagcaatcgcaattgatgaaatccaattttttgacgaggaaattgtaact
tttttagaacaaatcgccgataaaggaattcgggtaattgtcagcggccttgaccaagat
tttcgccgcaagccttttggtagtttaccaaatttaatggcaatcgccgaaaatgttact
aaattacaggcagtttgctcactttgtaaacgcgctgcaacaacaaccgcgcgtaaagtt
cttaatgaggcacaaactttaattggtgatcaagacgaatacgaagcacggtgccgtgct
tgtcatagtttataa

DBGET integrated database retrieval system