KEGG   Methanomethylovorans hollandica: Metho_0170Help
Entry
Metho_0170        CDS       T02418                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mhz  Methanomethylovorans hollandica
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mhz00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
172429..173298
Genome map
AA seq 289 aa AA seqDB search
MFHDLCMMDSLADYDSARYVLFGVPFDGTSSFRAGSRWAPDAMRKSSPNFETYNAYFDID
FEDLLIHDAGNFEPYSDVERTLEELFFAVEPIVKDGKLPIMMGGEHSLTYPCVKACAKHA
GEDIGFVVMDAHFDLREEYSGVKFNHACVSRHVLNDITDRYVTIGVRSGPREEWDFAKDH
GICYYTSDTVREKGVKAVLAEALEHLECDKIYLSLDMDALDPSFAPGLGTPEPFGLTDIE
VRDIIRVLAPMSIGFDVVEISPEYDGGQTALLGTKLLREFIAAHAAAHR
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgttccacgatctttgtatgatggattcactggcagattatgactctgccagatatgtt
ctctttggtgtcccctttgatggcacctcatctttccgagcgggcagcaggtgggctccg
gatgctatgcgcaagtcatctcctaattttgagacctataatgcatacttcgacatagat
tttgaggatctgctgatccatgatgcaggcaacttcgagccatattcggatgttgagagg
accctcgaagaacttttcttcgcagtggagccaattgtaaaggatgggaaactccccata
atgatgggtggagaacactctctcacatatccctgtgtgaaggcatgtgcaaaacatgct
ggcgaagatattggttttgtggtgatggatgctcatttcgacctgcgtgaagaatacagc
ggtgtgaaattcaatcatgcatgtgtttccaggcatgtactcaatgacatcactgacagg
tatgtgaccattggtgtgcgcagcggtcccagagaagaatgggatttcgcaaaagatcat
ggcatctgctactatacttctgatactgtaagagaaaaaggtgttaaagcagttcttgca
gaagcacttgagcaccttgaatgtgataagatttacctatctcttgacatggatgcattg
gacccatcctttgccccgggtttaggaactcccgaaccattcgggctgacggatatagag
gttagggatatcatacgtgttcttgctcctatgtccattgggtttgatgtagtcgagatt
tctccggaatacgatggtgggcaaactgccctcttgggtacgaagcttttacgtgagttc
attgcagcacatgctgcagcacacagatga

DBGET integrated database retrieval system