KEGG   Methanomethylovorans hollandica: Metho_0172Help
Entry
Metho_0172        CDS       T02418                                 

Definition
protein-L-isoaspartate and D-aspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mhz  Methanomethylovorans hollandica
Brite
Enzymes [BR:mhz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Metho_0172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
174065..174751
Genome map
AA seq 228 aa AA seqDB search
MGEWYFVEFSKKRAELVARLKVRGVSEKVLRAMTNVPRHLFVPSVHMSSAYVDTPLNIGH
GQTISAPHMVAIMCDLLDLQEGHKVLEVGAGSGYNAAVMAELIGNTGIVYSTERIPELVG
SSKNNIKAAGYRNIEVFLSDGSIGLPEHAPYDRICVTASAPSIPQPLVQQLKTGGRMVIP
VGDMFQSLYLVTRDSDGTVVTKEWGGVVFVPLIGKHGFHFEQKPYRHH
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgggggagtggtacttcgtggagttctcgaagaagagggcagagctggtagctcgcctg
aaggtccgtggtgtaagtgaaaaagttctcagggcaatgacaaatgtgcccagacatctt
tttgttccctctgtgcacatgtcaagtgcttatgtggatacacctcttaatatcgggcat
ggtcaaaccatatctgctcctcatatggtagctattatgtgtgatctgcttgatcttcag
gagggccacaaagtcctggaagtgggtgcaggttcggggtataatgctgcagttatggct
gaactcataggaaatactggtatagtatattctactgaaaggataccagagctggtcgga
tcatcaaaaaataatataaaggcagctggctatcgtaacatagaggtttttctttccgat
ggatctatagggctaccagaacacgctccctatgacaggatatgcgtgaccgcatcagca
ccctccattcctcaacctctggtgcagcagctaaaaacaggggggaggatggttattccg
gttggagatatgttccagtctctttatcttgttacaagggatagtgatggcacagtggtc
actaaagaatggggtggcgtagtttttgttcctctaatagggaaacatggtttccatttc
gagcagaaaccttatagacaccattga

DBGET integrated database retrieval system