KEGG   Methanomethylovorans hollandica: Metho_0443Help
Entry
Metho_0443        CDS       T02418                                 

Definition
ribulose-5-phosphate 4-epimerase-like epimerase or aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mhz  Methanomethylovorans hollandica
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mhz00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Metho_0443
Enzymes [BR:mhz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Metho_0443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
438352..438903
Genome map
AA seq 183 aa AA seqDB search
MWQEISRIGRKLVQSGLVESHFGNISVRMGDRMLITRSGSALDELTSDKIVEVEVQGTCA
LDVIASSETIVHRAIYNSTSAFAIVHAHCPYAVTMSLLQGEGCITPLDSEGRYFLGDIPI
VPGGIGSAELAENLAKALYCHKAAIVYGHGTFSIGRVLDEAYVLTTQVEHSCRIRYLHDL
MRK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgtggcaggagatatccaggataggtagaaaactggtacagagcgggcttgtggagtcc
cattttggcaacataagtgttcgtatgggtgacaggatgctcattacaagaagcggaagc
gccctggatgagctgacatcggataagatagtggaggtggaggtgcaaggcacctgcgcc
ctcgatgtcatcgcctcttcagagaccatagtccatcgcgccatctataatagcacttct
gcatttgccatcgtacatgcccactgtccctatgctgttactatgtctttgctgcagggc
gagggctgtatcactccgctagacagtgaaggccggtattttctgggcgatattcctata
gtcccgggaggtataggctctgcagagcttgctgaaaatctcgctaaggctctgtactgc
cataaagctgcaattgtgtatggacacggcacattctccataggccgtgtgcttgacgag
gcatatgtgcttacaacacaggtggaacattcctgcaggatcaggtatctgcacgatctg
atgcgcaagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system