KEGG   Methanomethylovorans hollandica: Metho_0488Help
Entry
Metho_0488        CDS       T02418                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mhz  Methanomethylovorans hollandica
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:mhz00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Metho_0488
   00052 Galactose metabolism
    Metho_0488
   00500 Starch and sucrose metabolism
    Metho_0488
   00520 Amino sugar and nucleotide sugar metabolism
    Metho_0488
Enzymes [BR:mhz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Metho_0488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(481934..482794)
Genome map
AA seq 286 aa AA seqDB search
MTIKKAVIPAAGLGTRFLPVTKSMPKEMLPIIDKPVIHYVVEEAVNSGIDDIIFVTGRSK
RSIEDYFDDSPELEMHLKSRGKTEMLKMIRDISSLVDIHYIRQKEPRGLGDAILTAEKHI
SGEPFAVLLGDDIIMNSTPCTKQLIEVFNTYGRSTIAVEEVPWEKVSNYGIIKGRELDEH
LYLLEDIVEKPAPEKAPSNTGAIGRYVFTPEIFDCIKATACGVGGEIQLTDGIKLLSESQ
KIYAYKFTGKRYDTGDKLGYIKAIVDFALKNEEMRDEILDHLRNFN
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcaagaaagcagttataccggctgcagggcttggcacaaggtttctcccggta
acaaaatccatgccaaaggaaatgcttccgatcattgataaacctgtgatccattatgta
gtggaggaagctgtcaactccggaatagatgacatcatattcgtgacaggtagaagcaaa
agatctatagaggattattttgacgattcacctgaactggaaatgcaccttaagagcagg
ggaaaaacagagatgctgaaaatgataagagacatctcttcccttgtggatatccactac
atccgacagaaagaaccacggggattgggagacgctatacttacagcagaaaagcatatt
agcggggaaccttttgctgtgcttttaggtgatgatataataatgaacagtaccccatgc
actaaacaacttatcgaggttttcaatacctacgggcgctcaaccatcgcagtggaagaa
gtaccctgggaaaaagttagcaattacggtataataaaaggacgcgaactggacgaacac
ctgtacctgcttgaggacatcgtggaaaaacctgcccccgagaaggctccatctaatacc
ggtgctattggaagatacgtattcactcctgagatattcgattgtataaaagcgacagct
tgcggtgtgggtggagagatacagcttaccgatggcatcaaactcctcagcgaatcccag
aagatctatgcatataagttcacaggcaaacgttatgacaccggtgacaaactgggatat
atcaaagccatagtggactttgctttaaagaacgaggaaatgagggatgagatactggac
catttaaggaatttcaattaa

DBGET integrated database retrieval system